HHsearch alignment for GI: 254780877 and conserved domain: pfam00448

>pfam00448 SRP54 SRP54-type protein, GTPase domain. This family includes relatives of the G-domain of the SRP54 family of proteins.
Probab=96.24  E-value=0.0048  Score=43.69  Aligned_cols=113  Identities=19%  Similarity=0.320  Sum_probs=52.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHCCCCC--CCCCCCH---HHHCCCCCCCHHHCCCCHHCCCCCC---CCCCHHH---HC
Q ss_conf             8987267861688999999987237765--3002244---7740345320130477112035667---7421132---21
Q gi|254780877|r  600 SFMFLGPTGVGKTELVKSLARLLFDDEN--SMIRIDM---SEYMEKHSVSRLIGSPPGYVGYEEG---GALTEAV---RR  668 (853)
Q Consensus       600 ~flf~GptGvGKTelak~la~~lf~~~~--~lir~dM---sey~e~~~vs~LiGappGYvG~~~g---g~Lte~v---r~  668 (853)
T Consensus         3 vi~lvGptGvGKTTTiaKLAa~~~~~~~~V~lit~Dt~R~gA~eQL~~ya~~l~v~~-~~~~~~~d~~~~~~~~l~~~~~   81 (196)
T pfam00448         3 VILLVGLQGSGKTTTIAKLAAYLKKQGKKVLLVAADTFRAAAIEQLKQLAERLGVPV-FGSGTGSDPAAVAFDAVEKAKA   81 (196)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEE-EECCCCCCHHHHHHHHHHHHHH
T ss_conf             999989999988999999999999779928999758776889999999998639817-8148777878999999999884


Q ss_pred             CCCCEEEEHHHHHCCHH--HHHHHHHHHHCCEEECCCCCEEECCCCEEEECCCHHHH
Q ss_conf             56410220214414989--99999998404578879997783033155954851268
Q gi|254780877|r  669 HPYQVVLFDEIEKAHSD--VHNILLQVLDDGRLTDSQGRTVDFRNTLIIMTSNLGAE  723 (853)
Q Consensus       669 ~P~sVil~DEiEKah~~--v~~~llqild~G~ltd~~G~~v~f~n~iii~TsN~G~~  723 (853)
T Consensus        82 ~~~D~IlIDTaGr~~~d~~~~~el~~~~~~~----------~~~~~~LVl~a~~~~~  128 (196)
T pfam00448        82 ENYDVVLVDTAGRLQNDKNLMDELKKIKRVI----------APDEVLLVLDATTGQN  128 (196)
T ss_pred             CCCCEEEEECCCCCCCCHHHHHHHHHHHHHC----------CCCCEEEEEECCCCCC
T ss_conf             6899999989998747677899999998522----------8730289985677821