RPSBLAST alignment for GI: 254780877 and conserved domain: PRK11034

>gnl|CDD|182917 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional. Length = 758
 Score =  288 bits (738), Expect = 5e-78
 Identities = 126/257 (49%), Positives = 182/257 (70%), Gaps = 4/257 (1%)

Query: 150 DSVNAEQ--GFDALKKYCRDLTEEARNGKLDPVIGRDDEMRRAIQVLSRRTKNNPVLIGD 207
              + EQ  G + ++ +  +L + AR G +DP+IGR+ E+ RAIQVL RR KNNP+L+G+
Sbjct: 156 QPNSEEQAGGEERMENFTTNLNQLARVGGIDPLIGREKELERAIQVLCRRRKNNPLLVGE 215

Query: 208 PGVGKTAIIEGLASRIINGDIPESLKGKRLMALDMGALIAGAKFRGEFEERLKSLLCEIR 267
            GVGKTAI EGLA RI+ GD+PE +    + +LD+G+L+AG K+RG+FE+R K+LL ++ 
Sbjct: 216 SGVGKTAIAEGLAWRIVQGDVPEVMADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLE 275

Query: 268 SEDGEIILFIDELHVLVGAGKTDGA-MDASNLLKPSLARGELHCIGATTLDEYRKYIEKD 326
            +    ILFIDE+H ++GAG   G  +DA+NL+KP L+ G++  IG+TT  E+    EKD
Sbjct: 276 QDT-NSILFIDEIHTIIGAGAASGGQVDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKD 334

Query: 327 PALARRFQSLLVGEPTVTDTISILRGLKERYEQHHKVRISDSALVSAAVLSNRYITDRFL 386
            ALARRFQ + + EP++ +T+ I+ GLK +YE HH VR +  A+ +A  L+ +YI DR L
Sbjct: 335 RALARRFQKIDITEPSIEETVQIINGLKPKYEAHHDVRYTAKAVRAAVELAVKYINDRHL 394

Query: 387 PDKAIDLMDEASARVRM 403
           PDKAID++DEA AR R+
Sbjct: 395 PDKAIDVIDEAGARARL 411