254780880
hypothetical protein CLIBASIA_03885
| GeneID in NCBI database: | 8209898 | Locus tag: | CLIBASIA_03885 |
| Protein GI in NCBI database: | 254780880 | Protein Accession: | YP_003065293.1 |
| Gene range: | +(856371, 856493) | Protein Length: | 40aa |
| Gene description: | hypothetical protein | ||
| COG prediction: | none | ||
| KEGG prediction: | hypothetical protein | ||
| SEED prediction: | not defined as a protein in SEED | ||
| Pathway involved in KEGG: | not defined | ||
| Subsystem involved in KEGG: | not defined | ||
| sequence | sequence profile | ||
Prediction of Local Sequence Properties
| Source | Summary | Result |
|---|
|
|
Close Homologs Detected by BLAST or PSI-BLAST
Homolog within the Genome Detected by BLAST
Original result of BLAST against C. L. asiaticus genome
| Identity | Alignment graph | Length | Definition | E-value | |
| Target | 40 | hypothetical protein CLIBASIA_03885 [Candidatus Liberib | |||
| 254780830 | 40 | hypothetical protein CLIBASIA_03615 [Candidatus Li | 1e-19 | ||
| 254780492 | 40 | hypothetical protein CLIBASIA_01895 [Candidatus Li | 1e-19 |
| >gi|254780830|ref|YP_003065243.1| hypothetical protein CLIBASIA_03615 [Candidatus Liberibacter asiaticus str. psy62] Length = 40 | Back alignment |
|---|
Score = 85.9 bits (211), Expect = 1e-19, Method: Compositional matrix adjust.
Identities = 40/40 (100%), Positives = 40/40 (100%)
Query: 1 MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40
MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH
Sbjct: 1 MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40
|
| >gi|254780492|ref|YP_003064905.1| hypothetical protein CLIBASIA_01895 [Candidatus Liberibacter asiaticus str. psy62] Length = 40 | Back alignment |
|---|
Score = 85.9 bits (211), Expect = 1e-19, Method: Compositional matrix adjust.
Identities = 40/40 (100%), Positives = 40/40 (100%)
Query: 1 MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40
MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH
Sbjct: 1 MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40
|
Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations
Original result of PSI-BLAST first 2 iterations
| Identity | Alignment graph | Length | Definition | Round | E-value |
| Target | 40 | hypothetical protein CLIBASIA_03885 [Candidatus Liberib | |||
| 254780492 | 40 | hypothetical protein CLIBASIA_01895 [Candidatus Liberib | 1 | 2e-15 | |
| 297182451 | 60 | hypothetical protein [uncultured Rhodospirillales bacte | 1 | 1e-04 | |
| 210623970 | 49 | hypothetical protein CLOHIR_02088 [Clostridium hiranoni | 1 | 0.002 | |
| 297184727 | 83 | hypothetical protein [uncultured alpha proteobacterium | 2 | 0.004 |
| >gi|254780492|ref|YP_003064905.1| hypothetical protein CLIBASIA_01895 [Candidatus Liberibacter asiaticus str. psy62] Length = 40 | Back alignment and organism information |
|---|
Score = 85.9 bits (211), Expect = 2e-15, Method: Compositional matrix adjust.
Identities = 40/40 (100%), Positives = 40/40 (100%)
Query: 1 MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40
MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH
Sbjct: 1 MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40
|
Species: Candidatus Liberibacter asiaticus Genus: Candidatus Liberibacter Family: Rhizobiaceae Order: Rhizobiales Class: Alphaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|297182451|gb|ADI18614.1| hypothetical protein [uncultured Rhodospirillales bacterium HF4000_24M03] Length = 60 | Back alignment and organism information |
|---|
| >gi|210623970|ref|ZP_03294136.1| hypothetical protein CLOHIR_02088 [Clostridium hiranonis DSM 13275] Length = 49 | Back alignment and organism information |
|---|
| >gi|297184727|gb|ADI20838.1| hypothetical protein [uncultured alpha proteobacterium EF100_102A06] Length = 83 | Back alignment and organism information |
|---|
Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch
Conserved Domains in CDD Database Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
Original result of RPS-BLAST against CDD database part II
No hit with e-value below 0.005
Conserved Domains in CDD Database Detected by HHsearch
Original result of HHsearch against CDD database
No hit with probability above 90.00
Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch
Homologous Structures Detected by PSI-BLAST against Nonredundant Database
No homologous structure with e-value below 0.005
Homologous Structures in PDB70 Database Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Homologous Structures in PDB70 Database Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 90.00
Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch
Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 90.00
Homologous Domains in MMDB70 Database Detected by RPS-BLAST
Original result of RPS-BLAST against MMDB70 database
No hit with e-value below 0.005
Homologous Domains in MMDB70 Database Detected by HHsearch
Original result of HHsearch against MMDB70 database
No hit with probability higher than 90.00