BLAST/PSIBLAST alignment of GI: 254780880 and GI: 210623970 at iteration 1
>gi|210623970|ref|ZP_03294136.1| hypothetical protein CLOHIR_02088 [Clostridium hiranonis DSM 13275] Length = 49
>gi|210153265|gb|EEA84271.1| hypothetical protein CLOHIR_02088 [Clostridium hiranonis DSM 13275] Length = 49
 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 22/33 (66%)

Query: 7  SNQARKGIWWMPWHAQAMKDVICCDKLWGAANK 39
          + Q  KG   MPWH + MKDVI CDKLWG A K
Sbjct: 16 TGQVIKGAGRMPWHREPMKDVISCDKLWGVARK 48