BLAST/PSIBLAST alignment of GI: 254780880 and GI: 297182451 at iteration 1
>gi|297182451|gb|ADI18614.1| hypothetical protein [uncultured Rhodospirillales bacterium HF4000_24M03] Length = 60
 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%)

Query: 11 RKGIWWMPWHAQAMKDVICCDKLWGAANKH 40
          +KGIWWMPW  +AMKDVI C+K  GAAN+H
Sbjct: 31 KKGIWWMPWRQEAMKDVIGCEKPRGAANRH 60