BLAST/BLAST alignment of GI: 254780880 and GI: 254780492
>gi|254780492|ref|YP_003064905.1| hypothetical protein CLIBASIA_01895 [Candidatus Liberibacter asiaticus str. psy62] Length = 40
 Score = 85.9 bits (211), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%)

Query: 1  MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40
          MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH
Sbjct: 1  MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40