PSIBLAST alignment of GI: 254780881 and protein with PDB id: 3lno

>gi|288965879|pdb|3LNO|A Chain A, Crystal Structure Of Domain Of Unknown Function Duf59 From Bacillus Anthracis Length = 108
>gi|288965880|pdb|3LNO|B Chain B, Crystal Structure Of Domain Of Unknown Function Duf59 From Bacillus Anthracis Length = 108
 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/92 (16%), Positives = 40/92 (43%), Gaps = 2/92 (2%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIV-HNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +N++  +L+ +  P    +IV +  + ++    +N   ++ T           + S+ ++
Sbjct: 10  ENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITXTXTSIGCPXAGQIVSDVKK 69

Query: 65  IIQ-NIPTVKNAVVTLTENKNPPQQRNNLNVK 95
           ++  N+P V    V +  N    ++R +   K
Sbjct: 70  VLSTNVPEVNEIEVNVVWNPPWSKERXSRXAK 101