RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780881|ref|YP_003065294.1| Mrp protein [Candidatus Liberibacter asiaticus str. psy62] (101 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 31.1 bits (70), Expect = 0.062 Identities = 16/100 (16%), Positives = 28/100 (28%), Gaps = 41/100 (41%) Query: 1 MNQIL--KNQIVDSLKVLSIPGEKNNIVE---------MQRLSEI------------F-- 35 N L Q+ SL + G KN +V L + F Sbjct: 356 TNSHLPAGKQVEISL----VNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLDQSRIPFSE 411 Query: 36 ----IVHNTVYLSITVP-HTIAHQLQSLRSNAQQIIQNIP 70 + +L + P H+ L + I +++ Sbjct: 412 RKLKFSNR--FLPVASPFHS-----HLLVPASDLINKDLV 444 Score = 28.0 bits (62), Expect = 0.56 Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 12/53 (22%) Query: 36 IVHNTVYLSITVP---HTIAHQLQ-----SLRSNAQQIIQNI-PTVKNAVVTL 79 + H ++ + VP IA QLQ L + + PT L Sbjct: 11 LSHGSLEHVLLVPTASFFIASQLQEQFNKILPEPTEGFAADDEPT---TPAEL 60 Score = 27.2 bits (60), Expect = 0.87 Identities = 8/56 (14%), Positives = 19/56 (33%), Gaps = 7/56 (12%) Query: 14 KVLSIPGEKNNIVE-MQRLSEIFIVHNTVYLSITVP--HTIAHQLQSLRSNAQQII 66 ++++I G + N + + L +++ Y + A L L Sbjct: 155 QLVAIFGGQGNTDDYFEELRDLY----QTYHVLVGDLIKFSAETLSELIRTTLDAE 206 >3k12_A Uncharacterized protein A6V7T0; structural genomics, unknown function, PSI-2, protein structure initiative; 1.49A {Pseudomonas aeruginosa} Length = 122 Score = 26.8 bits (59), Expect = 1.1 Identities = 12/56 (21%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Query: 29 QRLSEIFIVHNTVYLSITVPH----TIAHQLQSLRSNAQQIIQNIPTVKNAVVTLT 80 +R +E+ + NTVY+ V I Q + + N +++Q++ + + V+++ Sbjct: 9 KRRAEMALHGNTVYIGGQVADDPSGDIQDQTRQILENIDRLLQSVGSDRGQVLSVR 64 >2odr_C Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Length = 701 Score = 25.7 bits (56), Expect = 2.7 Identities = 1/17 (5%), Positives = 5/17 (29%) Query: 48 PHTIAHQLQSLRSNAQQ 64 H + ++ + Sbjct: 204 SHMTSGWFLTVSDLMNK 220 >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Length = 244 Score = 23.9 bits (51), Expect = 10.0 Identities = 6/32 (18%), Positives = 13/32 (40%) Query: 70 PTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA 101 P V ++++ L K+ ++ FV Sbjct: 167 PKVNSSLIRLNRKKSRISHKDKQKYNYFVMKW 198 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.316 0.129 0.343 Gapped Lambda K H 0.267 0.0569 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 740,284 Number of extensions: 26994 Number of successful extensions: 77 Number of sequences better than 10.0: 1 Number of HSP's gapped: 77 Number of HSP's successfully gapped: 11 Length of query: 101 Length of database: 5,693,230 Length adjustment: 66 Effective length of query: 35 Effective length of database: 4,093,126 Effective search space: 143259410 Effective search space used: 143259410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.4 bits)