RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780883|ref|YP_003065296.1| hypothetical protein CLIBASIA_03900 [Candidatus Liberibacter asiaticus str. psy62] (139 letters) >1o26_A Thymidylate synthase THYX; TM0449, thymidylate synthase complementing protein, structural genomics, JCSG, PSI; HET: FAD UMP PGE; 1.60A {Thermotoga maritima} (A:) Length = 232 Score = 25.3 bits (55), Expect = 3.1 Identities = 5/35 (14%), Positives = 9/35 (25%), Gaps = 3/35 (8%) Query: 56 RLIGIGIIRIYQLIFSNVF---GNSCRYLPTCSEY 87 + + I RI++ F E Sbjct: 196 QQYALAIARIFKEKCPWTFEAFLKYAYKGDILKEV 230 >3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase, translation termination, ATP-binding, cytoplasm, hydrolase, membrane; 2.80A {Schizosaccharomyces pombe} (A:1-326) Length = 326 Score = 25.1 bits (54), Expect = 4.0 Identities = 12/38 (31%), Positives = 18/38 (47%), Gaps = 7/38 (18%) Query: 27 IQKKGSPLLLKNNTP----KSRNWNGKFPKTLGRLIGI 60 IQ+K PLLL N +S++ G KT + + Sbjct: 145 IQEKALPLLLSNPPRNMIGQSQSGTG---KTAAFALTM 179 >3jrt_A Integron cassette protein VPC_CASS2; mobIle metagenome, structural genomics, PSI-2 protein structure initiative; 2.30A {Vibrio paracholerae} (A:) Length = 192 Score = 24.6 bits (53), Expect = 5.7 Identities = 7/26 (26%), Positives = 14/26 (53%) Query: 65 IYQLIFSNVFGNSCRYLPTCSEYGYE 90 I++L ++ N +Y+ +YG E Sbjct: 70 IWRLCVYSIVINCRKYVELNQKYGKE 95 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.319 0.140 0.443 Gapped Lambda K H 0.267 0.0546 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,148,374 Number of extensions: 50012 Number of successful extensions: 50 Number of sequences better than 10.0: 1 Number of HSP's gapped: 50 Number of HSP's successfully gapped: 5 Length of query: 139 Length of database: 4,956,049 Length adjustment: 80 Effective length of query: 59 Effective length of database: 2,251,649 Effective search space: 132847291 Effective search space used: 132847291 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.5 bits)