RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780883|ref|YP_003065296.1| hypothetical protein CLIBASIA_03900 [Candidatus Liberibacter asiaticus str. psy62] (139 letters) >d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 Score = 26.6 bits (58), Expect = 0.93 Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 6/30 (20%) Query: 12 DRYLTTFS------QSSYALPIQKKGSPLL 35 DR ++TFS Q Y+L K GS + Sbjct: 1 DRGVSTFSPEGRLFQVEYSLEAIKLGSTAI 30 >d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 Score = 26.1 bits (57), Expect = 1.1 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 6/32 (18%) Query: 10 SSDRYLTTFS------QSSYALPIQKKGSPLL 35 S DR +T FS Q YA KKGS + Sbjct: 1 SYDRAITVFSPDGHLFQVEYAQEAVKKGSTAV 32 >d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 Score = 25.8 bits (56), Expect = 1.3 Identities = 9/34 (26%), Positives = 10/34 (29%), Gaps = 6/34 (17%) Query: 8 STSSDRYLTTFS------QSSYALPIQKKGSPLL 35 S D T FS Q YA+ L Sbjct: 1 SRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCL 34 >d2hava1 c.94.1.2 (A:340-664) Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 325 Score = 25.4 bits (55), Expect = 1.7 Identities = 16/72 (22%), Positives = 29/72 (40%), Gaps = 2/72 (2%) Query: 9 TSSDRYLTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGII--RIY 66 SD T +A+ + KK + L +N ++ + +T G I +G++ +I Sbjct: 74 NKSDNCEDTPEAGYFAVAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKIN 133 Query: 67 QLIFSNVFGNSC 78 F F C Sbjct: 134 HCRFDEFFSEGC 145 >d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 244 Score = 25.3 bits (55), Expect = 2.0 Identities = 10/32 (31%), Positives = 13/32 (40%), Gaps = 6/32 (18%) Query: 8 STSSDRYLTTFS------QSSYALPIQKKGSP 33 S DR++T FS Q YA +G Sbjct: 5 SAGFDRHITIFSPEGRLYQVEYAFKAINQGGL 36 >d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 238 Score = 25.0 bits (54), Expect = 2.7 Identities = 9/30 (30%), Positives = 14/30 (46%), Gaps = 6/30 (20%) Query: 12 DRYLTTFS------QSSYALPIQKKGSPLL 35 D +T +S Q YA+ K+GS + Sbjct: 4 DNDVTVWSPQGRIHQIEYAMEAVKQGSATV 33 >d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Score = 24.7 bits (53), Expect = 3.1 Identities = 9/34 (26%), Positives = 10/34 (29%), Gaps = 6/34 (17%) Query: 8 STSSDRYLTTFS------QSSYALPIQKKGSPLL 35 S D T FS Q YAL + Sbjct: 2 SRRYDSRTTIFSPEGRLYQVEYALESISHAGTAI 35 >d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Score = 24.3 bits (52), Expect = 4.4 Identities = 11/30 (36%), Positives = 13/30 (43%), Gaps = 6/30 (20%) Query: 12 DRYLTTFS------QSSYALPIQKKGSPLL 35 D TFS Q YAL K+GS + Sbjct: 6 DGDTVTFSPTGRLFQVEYALEAIKQGSVTV 35 >d1eb7a1 a.3.1.5 (A:1-164) Di-heme cytochrome c peroxidase {Pseudomonas aeruginosa [TaxId: 287]} Length = 164 Score = 24.0 bits (51), Expect = 4.5 Identities = 4/15 (26%), Positives = 8/15 (53%) Query: 119 FDPVPDDLPPKKNNP 133 F P+P+ + + P Sbjct: 11 FKPIPEQVTELRGQP 25 >d2veaa2 d.110.2.4 (A:327-514) Phytochrome-like protein Cph1 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 188 Score = 24.1 bits (52), Expect = 4.5 Identities = 7/29 (24%), Positives = 12/29 (41%) Query: 24 ALPIQKKGSPLLLKNNTPKSRNWNGKFPK 52 A+PI + L + ++ NW G Sbjct: 102 AIPIARHNFLLWFRPEVLQTVNWGGDPNH 130 >d1whia_ b.39.1.1 (A:) Ribosomal protein L14 {Bacillus stearothermophilus [TaxId: 1422]} Length = 122 Score = 24.0 bits (52), Expect = 5.8 Identities = 9/28 (32%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Query: 110 KCNPLGSDGFDPVPDDLPPKKNNPKLLS 137 +P G+ F PV +L K+ K++S Sbjct: 90 DKSPRGTRIFGPVAREL-RDKDFMKIIS 116 >d2j01o1 b.39.1.1 (O:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]} Length = 122 Score = 23.5 bits (51), Expect = 6.3 Identities = 9/28 (32%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Query: 110 KCNPLGSDGFDPVPDDLPPKKNNPKLLS 137 + P G+ F PV +L +K K++S Sbjct: 90 QLEPRGTRVFGPVAREL-REKGFMKIVS 116 >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Score = 23.6 bits (50), Expect = 6.6 Identities = 9/73 (12%), Positives = 21/73 (28%), Gaps = 7/73 (9%) Query: 26 PIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLP--T 83 IQ++ ++K R+ + G+ I + L + P Sbjct: 42 AIQQRAIKQIIKG-----RDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRE 96 Query: 84 CSEYGYEAIARYG 96 + + + G Sbjct: 97 LAVQIQKGLLALG 109 >d1s58a_ b.121.5.2 (A:) Parvovirus (panleukopenia virus) capsid protein {Human parvovirus B19 [TaxId: 10798]} Length = 536 Score = 23.3 bits (50), Expect = 8.3 Identities = 10/69 (14%), Positives = 21/69 (30%) Query: 7 DSTSSDRYLTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIY 66 +T S +T + +P + + N +GK K +G + Sbjct: 10 GATFSANSVTCTFSRQFLIPYDPEHHYKVFSPAASSCHNASGKEAKVCTITPIMGYSTPW 69 Query: 67 QLIFSNVFG 75 + + N Sbjct: 70 RYLDFNALN 78 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.319 0.140 0.443 Gapped Lambda K H 0.267 0.0600 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 571,566 Number of extensions: 26482 Number of successful extensions: 55 Number of sequences better than 10.0: 1 Number of HSP's gapped: 55 Number of HSP's successfully gapped: 16 Length of query: 139 Length of database: 2,407,596 Length adjustment: 77 Effective length of query: 62 Effective length of database: 1,350,386 Effective search space: 83723932 Effective search space used: 83723932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (22.5 bits)