BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780883|ref|YP_003065296.1| hypothetical protein CLIBASIA_03900 [Candidatus Liberibacter asiaticus str. psy62] (139 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780883|ref|YP_003065296.1| hypothetical protein CLIBASIA_03900 [Candidatus Liberibacter asiaticus str. psy62] Length = 139 Score = 281 bits (720), Expect = 2e-78, Method: Compositional matrix adjust. Identities = 139/139 (100%), Positives = 139/139 (100%) Query: 1 MYYECKDSTSSDRYLTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGI 60 MYYECKDSTSSDRYLTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGI Sbjct: 1 MYYECKDSTSSDRYLTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGI 60 Query: 61 GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120 GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD Sbjct: 61 GIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFD 120 Query: 121 PVPDDLPPKKNNPKLLSKK 139 PVPDDLPPKKNNPKLLSKK Sbjct: 121 PVPDDLPPKKNNPKLLSKK 139 >gi|254780680|ref|YP_003065093.1| seryl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 430 Score = 20.8 bits (42), Expect = 9.6, Method: Composition-based stats. Identities = 10/28 (35%), Positives = 15/28 (53%) Query: 112 NPLGSDGFDPVPDDLPPKKNNPKLLSKK 139 N L +DG +P L P NN ++ K+ Sbjct: 399 NYLNADGSVTIPTVLRPYMNNLAVIKKE 426 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.140 0.443 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 102,126 Number of Sequences: 1233 Number of extensions: 4213 Number of successful extensions: 6 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 4 length of query: 139 length of database: 328,796 effective HSP length: 66 effective length of query: 73 effective length of database: 247,418 effective search space: 18061514 effective search space used: 18061514 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 34 (17.7 bits)