>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.

Probab=97.42 E-value=0.0061 Score=38.32 Aligned_cols=79 Identities=20% Similarity=0.123 Sum_probs=57.0 Q ss_pred CCHHCCCCCCCCCCCCCEEEEEECCCCEEEEEEEEEECCCEEEECC------CCCCCCCEEEE----CC----EEEEEEE Q ss_conf 5021025674777765136899579988989999874242045515------77899855897----34----6699999 Q gi|254780885|r 114 LQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVD------LQIEMFSKVLF----ND----ILGRVVR 179 (207) Q Consensus 114 l~e~R~h~R~vPr~~~~~~~l~l~DG~~~~criiDiS~SGAAi~~~------~rp~iGs~V~v----G~----~~grVVR 179 (207) T Consensus 566 ~~q~R~~~R~~~~~~---~~l~~~~g~~~~~~t~D~S~gG~~i~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~v~~ 642 (713) T TIGR03030 566 RRQRRSSPRIPCKIP---AEVQRDGGRWVEATVEDASVGGLGIKINAQGAPGPQLGAGVLVQIRPKRNGLPALKPARVRG 642 (713) T ss_pred CCCCCCCCCEEECCE---EEEEECCCCEEEEEEEECCCCCEEEEECCCCCCCCCCCCCCEEEEEECCCCEEEEEEEEEEE T ss_conf 554465661561324---99997899789999988167861798457767665678883399996579816787799995 Q ss_pred EECCEEEEEECCCCCC Q ss_conf 9389089997167784 Q gi|254780885|r 180 IFPGGIAIEFSSVQES 195 (207) Q Consensus 180 h~~~GfaVeF~~~q~~ 195 (207) T Consensus 643 ~~~~~~~l~f~~~~~~ 658 (713) T TIGR03030 643 AGGVMIGLEFSPLNVQ 658 (713) T ss_pred CCCCEEEEEEECCCHH T ss_conf 5897799998159989

HHsearch alignment for GI: 254780885 and conserved domain: TIGR03030