HHsearch alignment for GI: 254780885 and conserved domain: pfam07238

>pfam07238 PilZ PilZ domain. This domain is found in a wide variety of bacterial signalling proteins.
Probab=98.28  E-value=2.2e-05  Score=53.27  Aligned_cols=87  Identities=29%  Similarity=0.440  Sum_probs=36.6

Q ss_pred             HCCCEEEEEEEEEEEEECCCCCEEEEEEEECCCCEEEEECCCCCCCCCEEEE--EECCCCC---EEEEEEEECCCC---C
Q ss_conf             1062147999705799468983026999875685499942788767974999--9955443---769999930898---3
Q gi|254780885|r   13 QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV--FVEKVGR---IEGKVVNFDSNR---G   84 (207)
Q Consensus        13 rR~f~RV~v~l~GR~ll~d~~E~~C~t~diSpgg~~l~~~~~~~~~Gervv~--Yld~iGr---lEG~V~r~~~~~---G   84 (207)
T Consensus         2 rR~~~R~~~~~~~~~~~~~~~~~~~~~~DiS~gG~~i~~~~~-~~~g~~v~~~~~~~~~~~~~~~~~~Vv~~~~~~~~~~   80 (102)
T pfam07238         2 RRREPRVPVNLPVTLLLGGGELYSGVIIDISLGGAALRLPEP-LQLGDEVRLRLTLPDDGIKLLVPGRVVRIRPDGDGYG   80 (102)
T ss_pred             CCCCCEECEEEEEEEECCCCCEEEEEEHHHCCCCEEEECCCC-CCCCCEEEEEEEECCCCEEEEEEEEEEEECCCCCCEE
T ss_conf             678745035788999938998999996443788489970876-5579719999996999808982789999915898289


Q ss_pred             EEEEE-ECCHHHHHHHH
Q ss_conf             89999-76987899999
Q gi|254780885|r   85 YAVRI-VTSENERRKLA  100 (207)
Q Consensus        85 Fav~l-~~t~~kR~kLA  100 (207)
T Consensus        81 ~G~~F~~~~~~~~~~l~   97 (102)
T pfam07238        81 VGVQFLELDEESRRLLE   97 (102)
T ss_pred             EEEEEEECCHHHHHHHH
T ss_conf             98899539999999879