HHsearch alignment of GI: 254780885 and MMDB domain: 2gjg_A_124-248

>2gjg_A (A:124-248) Hypothetical protein PP4397; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; 2.25A {Pseudomonas putida KT2440}
Probab=96.74  E-value=0.0053  Score=38.32  Aligned_cols=75  Identities=13%  Similarity=0.053  Sum_probs=33.2

Q ss_pred             CEEEEEEEECCCCEEEEECCCCC---CCCCEEE-EEECCCC---CEEEEEEEECCC---CC--EEEEE-ECCHHHHHHHH
Q ss_conf             30269998756854999427887---6797499-9995544---376999993089---83--89999-76987899999
Q gi|254780885|r   34 EYNCIVREISPGGLCIVCDVPMF---LVGERSI-VFVEKVG---RIEGKVVNFDSN---RG--YAVRI-VTSENERRKLA  100 (207)
Q Consensus        34 E~~C~t~diSpgg~~l~~~~~~~---~~Gervv-~Yld~iG---rlEG~V~r~~~~---~G--Fav~l-~~t~~kR~kLA  100 (207)
                      -+.|++.|+|.||+++.++.+.+   .++..+. +-++--+   .+.|+|.++...   ..  +.++| +.++..+++|.
T Consensus        28 ~~~~~~~DIS~GG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~~~~~~~~~~~~~~G~~F~~l~~~~~~~L~  107 (125)
T 2gjg_A           28 AXRGKLLDISATGCKLRFEGNVEDRLQLGQVYERFKAGNPLGLVDTXVELRHLHYEERINTTFAGVRFHNLSGQAQRKIE  107 (125)
T ss_dssp             CEEEEEEEECSSEEEEEEESCCGGGCCTTCEEEEEEECTTTCEEEEEEEEEEEEEEGGGTEEEEEEEEESCCHHHHHHHH
T ss_pred             EEEEEEEEECCCCEEEEECCCCCCCCCCCEEEEEEEECCCCCEEEEEEEEEEEEECCCCCEEEEEEEEECCCHHHHHHHH
T ss_conf             67789986468854899557656566464399986754888616788999999963788708999999059999999999


Q ss_pred             HHHHHHHC
Q ss_conf             99998764
Q gi|254780885|r  101 DKLIWLAN  108 (207)
Q Consensus       101 ~qLtWlan  108 (207)
                      .-+.++..
T Consensus       108 ~~I~~~qr  115 (125)
T 2gjg_A          108 SFVYQLQR  115 (125)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHHHHH
T ss_conf             99999999