HHsearch alignment of GI: 254780885 and MMDB domain: 2gjg_A_124-248

>2gjg_A (A:124-248) Hypothetical protein PP4397; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; 2.25A {Pseudomonas putida KT2440}
Probab=96.32  E-value=0.011  Score=36.29  Aligned_cols=61  Identities=16%  Similarity=0.166  Sum_probs=44.5

Q ss_pred             ECCCCEEEEEEEEEECCCEEEECCCCCCCCC----EE---EE--C----CEEEEEEEEECC------EEEEEECCCCCCC
Q ss_conf             5799889899998742420455157789985----58---97--3----466999999389------0899971677842
Q gi|254780885|r  136 LNDNTKHSCKVIDISESGVSVSVDLQIEMFS----KV---LF--N----DILGRVVRIFPG------GIAIEFSSVQESN  196 (207)
Q Consensus       136 l~DG~~~~criiDiS~SGAAi~~~~rp~iGs----~V---~v--G----~~~grVVRh~~~------GfaVeF~~~q~~~  196 (207)
                      .++|..+.|++.|+|.+|+++.++...+.+.    .+   .+  +    .+.|+|++....      -+|++|..+-..+
T Consensus        23 ~~~~~~~~~~~~DIS~GG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~~~~~~~~~~~~~~G~~F~~l~~~~  102 (125)
T 2gjg_A           23 LKGNGAXRGKLLDISATGCKLRFEGNVEDRLQLGQVYERFKAGNPLGLVDTXVELRHLHYEERINTTFAGVRFHNLSGQA  102 (125)
T ss_dssp             CCSSSCEEEEEEEECSSEEEEEEESCCGGGCCTTCEEEEEEECTTTCEEEEEEEEEEEEEEGGGTEEEEEEEEESCCHHH
T ss_pred             CCCCCEEEEEEEEECCCCEEEEECCCCCCCCCCCEEEEEEEECCCCCEEEEEEEEEEEEECCCCCEEEEEEEEECCCHHH
T ss_conf             78883677899864688548995576565664643999867548886167889999999637887089999990599999