HHsearch alignment of GI: 254780885 and MMDB domain: 3cnr_A_

>3cnr_A (A:) Type IV fimbriae assembly protein; PILZ, xanthomonas citri, type IV pilus assembly, unknown function; HET: MSE; 1.90A {Xanthomonas axonopodis PV} PDB: 3dsg_A
Probab=96.25  E-value=0.0064  Score=37.81  Aligned_cols=71  Identities=20%  Similarity=0.339  Sum_probs=54.4

Q ss_pred             EEEE-CCCCEEEEEEEEEECCCEEEECCCCCCCCCEEEE-----C-----CEEEEEEEEEC--------CEEEEEECCCC
Q ss_conf             8995-7998898999987424204551577899855897-----3-----46699999938--------90899971677
Q gi|254780885|r  133 QLVL-NDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLF-----N-----DILGRVVRIFP--------GGIAIEFSSVQ  193 (207)
Q Consensus       133 ~l~l-~DG~~~~criiDiS~SGAAi~~~~rp~iGs~V~v-----G-----~~~grVVRh~~--------~GfaVeF~~~q  193 (207)
                      .+++ .++..+.|...|+|..|..+.++..+++|+.|.+     +     .+.|+|++.-+        .|+||+|...-
T Consensus        12 ~v~~~~~~~~~~~~~~diS~gGl~i~t~~~l~~G~~v~l~~~lp~~~~~i~~~g~V~w~~~~~~~~~~~~g~Gv~F~~~~   91 (117)
T 3cnr_A           12 SLALKDKPALYSAYXPFVKGGGIFVPTPKRYXLGDEVFLLLTLPDSSERLPVAGKVIWTTPAGAQGNRAAGIGVQFPDGP   91 (117)
T ss_dssp             EEECCSHHHHHHHEETTBTTCEEEEECCSCCCTTCEEEEEEECTTCSCEEEEEEEEEEEECC------CCEEEEECCSSH
T ss_pred             EEEECCHHHHHHHHCCCCCCCEEEEECCCCCCCCCEEEEEEEECCCCCEEEEEEEEEEECCCCCCCCCCCEEEEEECCCC
T ss_conf             99989999999984120679758971699778999999999953788268888999996678777888872799966688


Q ss_pred             CCCHHHHHHHH
Q ss_conf             84236778753
Q gi|254780885|r  194 ESNIAFKSLIN  204 (207)
Q Consensus       194 ~~~~~~~~~~~  204 (207)
                      +.+-+ +++|.
T Consensus        92 ~~~~~-r~~I~  101 (117)
T 3cnr_A           92 EGEAV-RNKIE  101 (117)
T ss_dssp             HHHHH-HHHHH
T ss_pred             CCHHH-HHHHH
T ss_conf             34789-99999