HHsearch results for GI: 254780885 and protein with PDBid: 2rde_A

>2rde_A Uncharacterized protein VCA0042; C-DI-GMP, structural genomics, PSI-2, protein structure initiative; HET: C2E; 1.92A {Vibrio cholerae O395} SCOP: b.45.2.1 b.45.2.2 PDB: 1yln_A* 3kyg_A*
Probab=97.57  E-value=0.00019  Score=46.27  Aligned_cols=96  Identities=19%  Similarity=0.293  Sum_probs=70.1

Q ss_pred             HHHHHHHCCCEEEEEEEEEEEEECCCCCEEEEEEEECCCCEEEEECCC--CCCCCCEEEEEEC-------CCCCEEEEEE
Q ss_conf             432220106214799970579946898302699987568549994278--8767974999995-------5443769999
Q gi|254780885|r    7 NLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVP--MFLVGERSIVFVE-------KVGRIEGKVV   77 (207)
Q Consensus         7 ~~~~~drR~f~RV~v~l~GR~ll~d~~E~~C~t~diSpgg~~l~~~~~--~~~~Gervv~Yld-------~iGrlEG~V~   77 (207)
                      .++..++|.|.||++.+++.+... ..++.|.+.|+|.||+++..+..  ...+|+.+.+.+.       ..-.++|+|.
T Consensus       128 ~ie~~qlR~~~Rv~v~lpa~l~~~-~~~~~g~i~DIS~gG~~~~~~~~~~~~~~g~~v~l~~~l~~~~~~~~~~l~g~Vr  206 (251)
T 2rde_A          128 TMQVSQLRKEPRFELNLAGKVLFD-EHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKIC  206 (251)
T ss_dssp             EEEEEECCSSCBEEEEEEEEEEET-TEEEEEEEEEECSSEEEEEECTTSCCCCTTCEEEEEEBSSTTSSCBCSCEEEEEE
T ss_pred             CEEEEEEECCEEEEEEEEEEEEEC-CEEEEEEEEEECCCCCEEEECCCCCCCCCCCEEEEEEEECCCCCCEEEEEEEEEE
T ss_conf             169995257788995238999989-9898999998645785899678776557998899999972699726799999999


Q ss_pred             EECC-CCCEEEEEECCHHH---HHHHHHHH
Q ss_conf             9308-98389999769878---99999999
Q gi|254780885|r   78 NFDS-NRGYAVRIVTSENE---RRKLADKL  103 (207)
Q Consensus        78 r~~~-~~GFav~l~~t~~k---R~kLA~qL  103 (207)
                      ++.. ..+..+-++..+-.   .++|-.||
T Consensus       207 ~v~~~~~~~~~Gv~F~~~~~~~~~~Ll~~L  236 (251)
T 2rde_A          207 NLQRSLHHARYGLEFNEEGRNNAKNLLAQL  236 (251)
T ss_dssp             EEEECSSCEEEEEEECHHHHHHHHHHHHHC
T ss_pred             EEEECCCCEEEEEEECCCCHHHHHHHHHHE
T ss_conf             989648938999998889989999999760