Query         gi|254780885|ref|YP_003065298.1| hypothetical protein CLIBASIA_03910 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 207
No_of_seqs    61 out of 63
Neff          4.3 
Searched_HMMs 23785
Date          Tue May 31 22:08:53 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780885.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1ywu_A Hypothetical protein PA  98.5 7.1E-07   3E-11   61.1   9.9   76  113-192    26-112 (149)
  2 1ywu_A Hypothetical protein PA  98.4 1.9E-06 7.9E-11   58.5   9.4  104    4-110    21-130 (149)
  3 2rde_A Uncharacterized protein  98.1 5.4E-05 2.3E-09   49.5  10.7   87  112-202   129-236 (251)
  4 2rde_A Uncharacterized protein  97.6 0.00019 7.8E-09   46.3   6.9   96    7-103   128-236 (251)
  5 3kyf_A PP4397, putative unchar  96.6   0.018 7.7E-07   34.1   9.5  147   29-194    31-215 (231)
  6 3kyf_A PP4397, putative unchar  95.0   0.075 3.2E-06   30.3   7.0  101    7-107   109-229 (231)
  7 3cnr_A Type IV fimbriae assemb  93.9   0.096   4E-06   29.7   5.4   45   35-80     22-71  (117)
  8 2qqr_A JMJC domain-containing   38.7      19 0.00079   15.6   5.2   35   56-91      6-41  (118)
  9 1ssf_A Transformation related   30.3      26  0.0011   14.8   3.4   35   56-90      9-44  (156)
 10 2h8r_A Hepatocyte nuclear fact  28.2      27  0.0011   14.7   2.2   13   91-103   167-179 (221)
 11 2q18_X 2-keto-3-deoxy-D-arabin  27.0      29  0.0012   14.4   4.5   25   84-109   158-182 (293)
 12 2hb0_A CFA/I fimbrial subunit   26.7      26  0.0011   14.7   1.9   85    7-94     79-179 (369)
 13 1khi_A HEX1; membrane sealing,  26.6      29  0.0012   14.5   2.1   64   23-91     42-121 (176)

No 1  
>1ywu_A Hypothetical protein PA4608; PAT7, beta barrel, PILZ domain, structural genomics, PSI, protein structure initiative; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.45.2.1
Probab=98.53  E-value=7.1e-07  Score=61.06  Aligned_cols=76  Identities=11%  Similarity=0.074  Sum_probs=47.7

Q ss_pred             CCCHHCCCCCCCCCCCCCEEEEEECCCCEEEEEEEEEECCCEEEECCC--CCCCCCEEEE---------CCEEEEEEEEE
Q ss_conf             750210256747777651368995799889899998742420455157--7899855897---------34669999993
Q gi|254780885|r  113 HLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDL--QIEMFSKVLF---------NDILGRVVRIF  181 (207)
Q Consensus       113 ~l~e~R~h~R~vPr~~~~~~~l~l~DG~~~~criiDiS~SGAAi~~~~--rp~iGs~V~v---------G~~~grVVRh~  181 (207)
                      .-.|.|++.|+.-..+   ++|... |..++|+++|+|+.|+.|.++.  .++.|..|.+         -.+.|+|||.-
T Consensus        26 ~~dERRrf~Ri~~~~~---a~L~~~-~~~~~~~v~DISl~G~~i~~~~~~~l~~~~~v~l~l~l~~~~~i~l~a~Vvr~~  101 (149)
T 1ywu_A           26 QHDERRRFHRIAFDAD---SEILQG-ERRWEVLLHDVSLHGILVGQPQDWNGDPQRPFEARLYLGLDVLIRMEISLAWAR  101 (149)
T ss_dssp             CCCSSCCCCSSCCSCE---EEEEET-TEEEEEEEEEECSSEEEEECSSCCCCCTTSEEEEEEESSSSCEEEEEEEEEEEE
T ss_pred             CCCCCCCCEEEEEEEE---EEEEEC-CEEEEEEEEECCCCCEEEECCCCCCCCCCCEEEEEEECCCCCEEEEEEEEEEEC
T ss_conf             9532478767887105---999989-989999999824897799758876788996499999869986389999999863


Q ss_pred             CCEEEEEECCC
Q ss_conf             89089997167
Q gi|254780885|r  182 PGGIAIEFSSV  192 (207)
Q Consensus       182 ~~GfaVeF~~~  192 (207)
                      ++++|++|..+
T Consensus       102 ~~~lGl~F~~i  112 (149)
T 1ywu_A          102 DGLLGFECQHI  112 (149)
T ss_dssp             TTEEEEEEEEE
T ss_pred             CCEEEEEEEEC
T ss_conf             87642498845


No 2  
>1ywu_A Hypothetical protein PA4608; PAT7, beta barrel, PILZ domain, structural genomics, PSI, protein structure initiative; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.45.2.1
Probab=98.40  E-value=1.9e-06  Score=58.50  Aligned_cols=104  Identities=14%  Similarity=0.070  Sum_probs=78.0

Q ss_pred             HHHHHHHHHHCCCEEEEEEEEEEEEECCCCCEEEEEEEECCCCEEEEECCCC-CCCCCEEEEEEC----CCCCEEEEEEE
Q ss_conf             1234322201062147999705799468983026999875685499942788-767974999995----54437699999
Q gi|254780885|r    4 GIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPM-FLVGERSIVFVE----KVGRIEGKVVN   78 (207)
Q Consensus         4 ~~~~~~~~drR~f~RV~v~l~GR~ll~d~~E~~C~t~diSpgg~~l~~~~~~-~~~Gervv~Yld----~iGrlEG~V~r   78 (207)
                      |.-+-..-|||+|.||+++.++..-.+ ...|+|++.|+|.+|+.+.++.+. ...|+.+.++|.    ..-.++|+|++
T Consensus        21 ~~m~~~~dERRrf~Ri~~~~~a~L~~~-~~~~~~~v~DISl~G~~i~~~~~~~l~~~~~v~l~l~l~~~~~i~l~a~Vvr   99 (149)
T 1ywu_A           21 GHMSDQHDERRRFHRIAFDADSEILQG-ERRWEVLLHDVSLHGILVGQPQDWNGDPQRPFEARLYLGLDVLIRMEISLAW   99 (149)
T ss_dssp             --CCSCCCSSCCCCSSCCSCEEEEEET-TEEEEEEEEEECSSEEEEECSSCCCCCTTSEEEEEEESSSSCEEEEEEEEEE
T ss_pred             CCCCCCCCCCCCCEEEEEEEEEEEEEC-CEEEEEEEEECCCCCEEEECCCCCCCCCCCEEEEEEECCCCCEEEEEEEEEE
T ss_conf             123789532478767887105999989-9899999998248977997588767889964999998699863899999998


Q ss_pred             ECCCCCEEEEEECCHH-HHHHHHHHHHHHHCCC
Q ss_conf             3089838999976987-8999999999876424
Q gi|254780885|r   79 FDSNRGYAVRIVTSEN-ERRKLADKLIWLANKD  110 (207)
Q Consensus        79 ~~~~~GFav~l~~t~~-kR~kLA~qLtWlanr~  110 (207)
                      ...+ +..+.|...+. .-.+| .+|.|+-.-+
T Consensus       100 ~~~~-~lGl~F~~iD~ds~~~L-r~lIeln~~d  130 (149)
T 1ywu_A          100 ARDG-LLGFECQHIDLDSISHL-RRLVELNLGD  130 (149)
T ss_dssp             EETT-EEEEEEEEECHHHHHHH-HHHHHHHTCC
T ss_pred             ECCC-EEEEEEEECCHHHHHHH-HHHHHHHCCC
T ss_conf             6387-64249884599999999-9999863899


No 3  
>2rde_A Uncharacterized protein VCA0042; C-DI-GMP, structural genomics, PSI-2, protein structure initiative; HET: C2E; 1.92A {Vibrio cholerae O395} SCOP: b.45.2.1 b.45.2.2 PDB: 1yln_A* 3kyg_A*
Probab=98.05  E-value=5.4e-05  Score=49.54  Aligned_cols=87  Identities=16%  Similarity=0.251  Sum_probs=59.7

Q ss_pred             CCCCHHCCCCCCCCCCCCCEEEEEECCCCEEEEEEEEEECCCEEEECCCC---CCCCCEEEE-------C-----CEEEE
Q ss_conf             67502102567477776513689957998898999987424204551577---899855897-------3-----46699
Q gi|254780885|r  112 LHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQ---IEMFSKVLF-------N-----DILGR  176 (207)
Q Consensus       112 l~l~e~R~h~R~vPr~~~~~~~l~l~DG~~~~criiDiS~SGAAi~~~~r---p~iGs~V~v-------G-----~~~gr  176 (207)
                      .-.-..|.|.|+.-.-|   +++.. ++..+.|.+.|+|.+|+++..+..   +.+|..+.+       |     .+.|+
T Consensus       129 ie~~qlR~~~Rv~v~lp---a~l~~-~~~~~~g~i~DIS~gG~~~~~~~~~~~~~~g~~v~l~~~l~~~~~~~~~~l~g~  204 (251)
T 2rde_A          129 MQVSQLRKEPRFELNLA---GKVLF-DEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGK  204 (251)
T ss_dssp             EEEEECCSSCBEEEEEE---EEEEE-TTEEEEEEEEEECSSEEEEEECTTSCCCCTTCEEEEEEBSSTTSSCBCSCEEEE
T ss_pred             EEEEEEECCEEEEEEEE---EEEEE-CCEEEEEEEEEECCCCCEEEECCCCCCCCCCCEEEEEEEECCCCCCEEEEEEEE
T ss_conf             69995257788995238---99998-998989999986457858996787765579988999999726997267999999


Q ss_pred             EEEEECCE----EEEEECCCCCCC--HHHHHH
Q ss_conf             99993890----899971677842--367787
Q gi|254780885|r  177 VVRIFPGG----IAIEFSSVQESN--IAFKSL  202 (207)
Q Consensus       177 VVRh~~~G----faVeF~~~q~~~--~~~~~~  202 (207)
                      |++....+    +|++|.++.+.+  .|..++
T Consensus       205 Vr~v~~~~~~~~~Gv~F~~~~~~~~~~Ll~~L  236 (251)
T 2rde_A          205 ICNLQRSLHHARYGLEFNEEGRNNAKNLLAQL  236 (251)
T ss_dssp             EEEEEECSSCEEEEEEECHHHHHHHHHHHHHC
T ss_pred             EEEEEECCCCEEEEEEECCCCHHHHHHHHHHE
T ss_conf             99989648938999998889989999999760


No 4  
>2rde_A Uncharacterized protein VCA0042; C-DI-GMP, structural genomics, PSI-2, protein structure initiative; HET: C2E; 1.92A {Vibrio cholerae O395} SCOP: b.45.2.1 b.45.2.2 PDB: 1yln_A* 3kyg_A*
Probab=97.57  E-value=0.00019  Score=46.27  Aligned_cols=96  Identities=19%  Similarity=0.293  Sum_probs=70.1

Q ss_pred             HHHHHHHCCCEEEEEEEEEEEEECCCCCEEEEEEEECCCCEEEEECCC--CCCCCCEEEEEEC-------CCCCEEEEEE
Q ss_conf             432220106214799970579946898302699987568549994278--8767974999995-------5443769999
Q gi|254780885|r    7 NLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVP--MFLVGERSIVFVE-------KVGRIEGKVV   77 (207)
Q Consensus         7 ~~~~~drR~f~RV~v~l~GR~ll~d~~E~~C~t~diSpgg~~l~~~~~--~~~~Gervv~Yld-------~iGrlEG~V~   77 (207)
                      .++..++|.|.||++.+++.+... ..++.|.+.|+|.||+++..+..  ...+|+.+.+.+.       ..-.++|+|.
T Consensus       128 ~ie~~qlR~~~Rv~v~lpa~l~~~-~~~~~g~i~DIS~gG~~~~~~~~~~~~~~g~~v~l~~~l~~~~~~~~~~l~g~Vr  206 (251)
T 2rde_A          128 TMQVSQLRKEPRFELNLAGKVLFD-EHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKIC  206 (251)
T ss_dssp             EEEEEECCSSCBEEEEEEEEEEET-TEEEEEEEEEECSSEEEEEECTTSCCCCTTCEEEEEEBSSTTSSCBCSCEEEEEE
T ss_pred             CEEEEEEECCEEEEEEEEEEEEEC-CEEEEEEEEEECCCCCEEEECCCCCCCCCCCEEEEEEEECCCCCCEEEEEEEEEE
T ss_conf             169995257788995238999989-9898999998645785899678776557998899999972699726799999999


Q ss_pred             EECC-CCCEEEEEECCHHH---HHHHHHHH
Q ss_conf             9308-98389999769878---99999999
Q gi|254780885|r   78 NFDS-NRGYAVRIVTSENE---RRKLADKL  103 (207)
Q Consensus        78 r~~~-~~GFav~l~~t~~k---R~kLA~qL  103 (207)
                      ++.. ..+..+-++..+-.   .++|-.||
T Consensus       207 ~v~~~~~~~~~Gv~F~~~~~~~~~~Ll~~L  236 (251)
T 2rde_A          207 NLQRSLHHARYGLEFNEEGRNNAKNLLAQL  236 (251)
T ss_dssp             EEEECSSCEEEEEEECHHHHHHHHHHHHHC
T ss_pred             EEEECCCCEEEEEEECCCCHHHHHHHHHHE
T ss_conf             989648938999998889989999999760


No 5  
>3kyf_A PP4397, putative uncharacterized protein; C-DI-GMP, PILZ domain, VCA0042, unknown function; HET: 5GP; 2.10A {Pseudomonas putida} PDB: 2gjg_A
Probab=96.62  E-value=0.018  Score=34.08  Aligned_cols=147  Identities=13%  Similarity=0.125  Sum_probs=81.9

Q ss_pred             ECCCC-CEEEEEEEECCCCEEEEECCCCC-------CCCCEEEEEECCCC---CEEEEE-EEE--CCCCCEEEEEECCHH
Q ss_conf             46898-30269998756854999427887-------67974999995544---376999-993--089838999976987
Q gi|254780885|r   29 LFDGT-EYNCIVREISPGGLCIVCDVPMF-------LVGERSIVFVEKVG---RIEGKV-VNF--DSNRGYAVRIVTSEN   94 (207)
Q Consensus        29 l~d~~-E~~C~t~diSpgg~~l~~~~~~~-------~~Gervv~Yld~iG---rlEG~V-~r~--~~~~GFav~l~~t~~   94 (207)
                      ..++. .|.+...++.+..-.+.-+...|       ..|+.+.++..+=|   .|...+ .+.  .++ .=++.+...+ 
T Consensus        31 ~~~~~~~~~t~il~vd~~~~~~~lD~~~~~~~n~~l~~g~~~~~~~~~~gv~i~F~~~~~~~~~e~~~-~~~~~~~~P~-  108 (231)
T 3kyf_A           31 FHDRSHRFQSYVVHVDRESNTLALDEMIPRDGEKFIENGEHFRVEGFHDGVRIAWECDHALKISEVDG-HRCYSGPLPQ-  108 (231)
T ss_dssp             ETTCCCEEEECEEEEETTTTEEEEECCBSGGGHHHHHTTCCEEEEEEETTEEEEEEECSCCEEEEETT-EEEEEECCCS-
T ss_pred             ECCCCCEEEEEEEEEECCCCEEEEECCCCHHHHHHHCCCCEEEEEEEECCEEEEEEECCEEEEEEECC-CEEEEECCCH-
T ss_conf             98999689999999968899899955896577587457966999999799899999773389987789-4599944966-


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCHHCCCCCCCCCCCCCEEEEE-----ECCCCEEEEEEEEEECCCEEEECCCCC----CCC
Q ss_conf             89999999998764243675021025674777765136899-----579988989999874242045515778----998
Q gi|254780885|r   95 ERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLV-----LNDNTKHSCKVIDISESGVSVSVDLQI----EMF  165 (207)
Q Consensus        95 kR~kLA~qLtWlanr~~l~l~e~R~h~R~vPr~~~~~~~l~-----l~DG~~~~criiDiS~SGAAi~~~~rp----~iG  165 (207)
                                      .+-.-..|.+-|+....... ....     .+|+..+.+++.|+|..|+++.++...    .+|
T Consensus       109 ----------------~l~~~QRR~~~Rv~~~~~~~-~~~~~~~~~~~~~~~~~~~l~DIS~GG~~l~~~~~~~~~~~~g  171 (231)
T 3kyf_A          109 ----------------EVTYHQRRNAFRAALKLSQL-VDIILDGAHLKGNGAMRGKLLDISATGCKLRFEGNVEDRLQLG  171 (231)
T ss_dssp             ----------------CEEEECCCSSCCEECCGGGC-CEEEECCTTCCSSSCEEEEEEEECSSEEEEEEEBCCGGGCCTT
T ss_pred             ----------------HHEEEEEHHEEEECCCCCCE-EEEEECCCCCCCCCEEEEEEEEECCCCEEEEECCCCCCCCCCC
T ss_conf             ----------------82883111007853788847-9999626777888546789996577755899657655567663


Q ss_pred             CEE---EE----C--CEEEEEEEEECC----E--EEEEECCCCC
Q ss_conf             558---97----3--466999999389----0--8999716778
Q gi|254780885|r  166 SKV---LF----N--DILGRVVRIFPG----G--IAIEFSSVQE  194 (207)
Q Consensus       166 s~V---~v----G--~~~grVVRh~~~----G--faVeF~~~q~  194 (207)
                      ..+   .+    |  .+.++|++....    +  ++++|.++-.
T Consensus       172 ~~~~~~~~~~~~~~~~~~~~vr~~~~~~~~~~~~~G~~F~~l~~  215 (231)
T 3kyf_A          172 QVYERFKAGNPLGLVDTMVELRHLHYEERINTTFAGVRFHNLSG  215 (231)
T ss_dssp             CEEEEEEETTTTCEEEEEEEEEEEEEEGGGTEEEEEEEEESCCH
T ss_pred             EEEEEEEECCCCCEEEEEEEEEEEEECCCCCEEEEEEEECCCCH
T ss_conf             39998786278846877899999985488876999999888999


No 6  
>3kyf_A PP4397, putative uncharacterized protein; C-DI-GMP, PILZ domain, VCA0042, unknown function; HET: 5GP; 2.10A {Pseudomonas putida} PDB: 2gjg_A
Probab=95.02  E-value=0.075  Score=30.32  Aligned_cols=101  Identities=15%  Similarity=0.095  Sum_probs=63.3

Q ss_pred             HHHHHHHCCCEEEEEEEEEEEE--E-----CCCCCEEEEEEEECCCCEEEEECCCCC---CCCCEEE-EEEC-CCCC--E
Q ss_conf             4322201062147999705799--4-----689830269998756854999427887---6797499-9995-5443--7
Q gi|254780885|r    7 NLQFIDQRAFQRVKVDLKGRFL--L-----FDGTEYNCIVREISPGGLCIVCDVPMF---LVGERSI-VFVE-KVGR--I   72 (207)
Q Consensus         7 ~~~~~drR~f~RV~v~l~GR~l--l-----~d~~E~~C~t~diSpgg~~l~~~~~~~---~~Gervv-~Yld-~iGr--l   72 (207)
                      .+..++||.|-||++.+.-.+.  +     ++...+.+.+.|||.||+++.++.+.+   ..|+.+. +-++ ..|.  +
T Consensus       109 ~l~~~QRR~~~Rv~~~~~~~~~~~~~~~~~~~~~~~~~~l~DIS~GG~~l~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~  188 (231)
T 3kyf_A          109 EVTYHQRRNAFRAALKLSQLVDIILDGAHLKGNGAMRGKLLDISATGCKLRFEGNVEDRLQLGQVYERFKAGNPLGLVDT  188 (231)
T ss_dssp             CEEEECCCSSCCEECCGGGCCEEEECCTTCCSSSCEEEEEEEECSSEEEEEEEBCCGGGCCTTCEEEEEEETTTTCEEEE
T ss_pred             HHEEEEEHHEEEECCCCCCEEEEEECCCCCCCCCEEEEEEEEECCCCEEEEECCCCCCCCCCCEEEEEEEECCCCCEEEE
T ss_conf             82883111007853788847999962677788854678999657775589965765556766339998786278846877


Q ss_pred             EEEEEEECC---CCCE--EEEE-ECCHHHHHHHHHHHHHHH
Q ss_conf             699999308---9838--9999-769878999999999876
Q gi|254780885|r   73 EGKVVNFDS---NRGY--AVRI-VTSENERRKLADKLIWLA  107 (207)
Q Consensus        73 EG~V~r~~~---~~GF--av~l-~~t~~kR~kLA~qLtWla  107 (207)
                      .++|.++..   ..++  -++| +.++..+++|..=+..+.
T Consensus       189 ~~~vr~~~~~~~~~~~~~G~~F~~l~~~~e~~I~ryI~~~q  229 (231)
T 3kyf_A          189 MVELRHLHYEERINTTFAGVRFHNLSGQAQRKIESFVYQLQ  229 (231)
T ss_dssp             EEEEEEEEEEGGGTEEEEEEEEESCCHHHHHHHHHHHHHHH
T ss_pred             EEEEEEEEECCCCCEEEEEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             89999998548887699999988899999999999999986


No 7  
>3cnr_A Type IV fimbriae assembly protein; PILZ, xanthomonas citri, type IV pilus assembly, unknown function; HET: MSE; 1.90A {Xanthomonas axonopodis PV} PDB: 3dsg_A
Probab=93.89  E-value=0.096  Score=29.66  Aligned_cols=45  Identities=16%  Similarity=0.402  Sum_probs=24.9

Q ss_pred             EEEEEEEECCCCEEEEECCCCCCCCCEEEEEECCCCC-----EEEEEEEEC
Q ss_conf             0269998756854999427887679749999955443-----769999930
Q gi|254780885|r   35 YNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR-----IEGKVVNFD   80 (207)
Q Consensus        35 ~~C~t~diSpgg~~l~~~~~~~~~Gervv~Yld~iGr-----lEG~V~r~~   80 (207)
                      |.|-..++|.||+.+.++.+ ..+|++|-+-|.--+.     ++|+|+.+.
T Consensus        22 ~~aYm~~is~GGlFv~T~~p-~~~Gt~v~l~l~Lp~~~~~~~~~g~V~W~~   71 (117)
T 3cnr_A           22 YSAYMPFVKGGGIFVPTPKR-YMLGDEVFLLLTLPDSSERLPVAGKVIWTT   71 (117)
T ss_dssp             HHHEETTBTTCEEEEECCSC-CCTTCEEEEEEECTTCSCEEEEEEEEEEEE
T ss_pred             HHHHCCCCCCCEEEEECCCC-CCCCCEEEEEEEECCCCCEEEEEEEEEEEC
T ss_conf             99843216785699846998-799999999999547882577778999955


No 8  
>2qqr_A JMJC domain-containing histone demethylation protein 3A; histone lysine demethylase, tandem hybrid tudor domains, metal binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 b.34.9.1 PDB: 2qqs_A* 2gfa_A* 2gf7_A*
Probab=38.69  E-value=19  Score=15.64  Aligned_cols=35  Identities=23%  Similarity=0.367  Sum_probs=25.7

Q ss_pred             CCCCCEEEEEECCCCCE-EEEEEEECCCCCEEEEEEC
Q ss_conf             76797499999554437-6999993089838999976
Q gi|254780885|r   56 FLVGERSIVFVEKVGRI-EGKVVNFDSNRGYAVRIVT   91 (207)
Q Consensus        56 ~~~Gervv~Yld~iGrl-EG~V~r~~~~~GFav~l~~   91 (207)
                      -.+|++|.+.... |++ .|+|+++.+...|.|.+.-
T Consensus         6 l~vG~~V~a~~~~-g~~y~g~I~~v~~~~~y~V~fdD   41 (118)
T 2qqr_A            6 ITAGQKVISKHKN-GRFYQCEVVRLTTETFYEVNFDD   41 (118)
T ss_dssp             CCTTCEEEEECTT-SSEEEEEEEEEEEEEEEEEEETT
T ss_pred             CCCCCEEEEEECC-CCEEEEEEEEECCCCEEEEEECC
T ss_conf             6789999999679-98888899998578889999859


No 9  
>1ssf_A Transformation related protein 53 binding protein 1; tudor domains, tandem, SH3-like fold, beta barrel, alpha- helix, cell cycle; NMR {Mus musculus} SCOP: b.34.9.1 b.34.9.1
Probab=30.32  E-value=26  Score=14.80  Aligned_cols=35  Identities=20%  Similarity=0.196  Sum_probs=26.1

Q ss_pred             CCCCCEEEEEECCCCCE-EEEEEEECCCCCEEEEEE
Q ss_conf             76797499999554437-699999308983899997
Q gi|254780885|r   56 FLVGERSIVFVEKVGRI-EGKVVNFDSNRGYAVRIV   90 (207)
Q Consensus        56 ~~~Gervv~Yld~iGrl-EG~V~r~~~~~GFav~l~   90 (207)
                      -.+|+||++....-|++ +|+|.++..+.-|.|.+.
T Consensus         9 ~~vG~rV~Ak~~~~g~~y~g~V~~~~~~~~y~V~fd   44 (156)
T 1ssf_A            9 SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFD   44 (156)
T ss_dssp             CSTTCEEEECSSCSSEEEEEEEEECCTTTEEEEECT
T ss_pred             CCCCCEEEEEECCCCEEEEEEEEEEECCCEEEEEEC
T ss_conf             558999999978999288899999907988999988


No 10 
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens}
Probab=28.24  E-value=27  Score=14.66  Aligned_cols=13  Identities=31%  Similarity=0.493  Sum_probs=7.2

Q ss_pred             CCHHHHHHHHHHH
Q ss_conf             6987899999999
Q gi|254780885|r   91 TSENERRKLADKL  103 (207)
Q Consensus        91 ~t~~kR~kLA~qL  103 (207)
                      -+..+|+.||.+|
T Consensus       167 P~~~~r~~lA~~~  179 (221)
T 2h8r_A          167 PSKEEREALVEEC  179 (221)
T ss_dssp             CCHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHH
T ss_conf             7999999999996


No 11 
>2q18_X 2-keto-3-deoxy-D-arabinonate dehydratase; FAH-family fold, lyase; 2.10A {Sulfolobus solfataricus P2} PDB: 2q19_X 2q1a_X 2q1c_X 2q1d_X 3bqb_A
Probab=27.04  E-value=29  Score=14.45  Aligned_cols=25  Identities=20%  Similarity=0.248  Sum_probs=14.2

Q ss_pred             CEEEEEECCHHHHHHHHHHHHHHHCC
Q ss_conf             38999976987899999999987642
Q gi|254780885|r   84 GYAVRIVTSENERRKLADKLIWLANK  109 (207)
Q Consensus        84 GFav~l~~t~~kR~kLA~qLtWlanr  109 (207)
                      ||.+-...|.|--.+ ...+-|...|
T Consensus       158 Gytv~ND~S~Rd~q~-~~~~~~~~~K  182 (293)
T 2q18_X          158 GYTIMDDVSARDLEA-ENPLYLPQSK  182 (293)
T ss_dssp             EEEEEEECEEHHHHH-HCGGGHHHHH
T ss_pred             EEEEECCCCHHHHHH-CCCCCCCCCC
T ss_conf             599812674676563-0567676645


No 12 
>2hb0_A CFA/I fimbrial subunit E; CFAE, adhesin, ETEC, traveler'S disease, cell adhesion; 2.30A {Escherichia coli}
Probab=26.71  E-value=26  Score=14.73  Aligned_cols=85  Identities=14%  Similarity=0.275  Sum_probs=54.0

Q ss_pred             HHHHHHHCCCEEEEEEEEEEEEECCCCCEEEEEEEECCCCEEEEECCCCCCCCCEEEEEECC--C------CCEEEEEEE
Q ss_conf             43222010621479997057994689830269998756854999427887679749999955--4------437699999
Q gi|254780885|r    7 NLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEK--V------GRIEGKVVN   78 (207)
Q Consensus         7 ~~~~~drR~f~RV~v~l~GR~ll~d~~E~~C~t~diSpgg~~l~~~~~~~~~Gervv~Yld~--i------GrlEG~V~r   78 (207)
                      .|+|.|||.-.+..+.|.| |+-.-.....| ...+........|... ...|.-+.+||..  +      |.-+|++.=
T Consensus        79 ~L~fTEqRSg~~~~L~l~G-y~~~~~~~~~c-~~~~~~ns~~~~c~~~-~~~g~~ltlyIPq~El~kLP~gG~Wka~LkL  155 (369)
T 2hb0_A           79 TLQFTEKRSLIKRELQIKG-YKQFLFKNANC-PSKLALNSSHFQCNRE-QASGATLSLYIPAGELNKLPFGGVWNAVLKL  155 (369)
T ss_dssp             EEEEEETTTCCEEEEEEEE-EEEEECSSCCC-CCCBCTTCCCCCBTTB-CCCEEEEEEEECTTGGGGCSSCEEEEEEEEE
T ss_pred             EEEEEEHHCCCEEEEEEEE-EEEEHHCCCCC-CCCEEECCCCCCCCCC-CCCCEEEEEEECHHHHHCCCCCCEEEEEEEE
T ss_conf             9999822269736998756-75311228863-3324311342124676-6786339999648997369867678889999


Q ss_pred             EC--------CCCCEEEEEECCHH
Q ss_conf             30--------89838999976987
Q gi|254780885|r   79 FD--------SNRGYAVRIVTSEN   94 (207)
Q Consensus        79 ~~--------~~~GFav~l~~t~~   94 (207)
                      ..        ...-|.++|+.|+.
T Consensus       156 ~~~~~~~~p~gty~adITl~vTD~  179 (369)
T 2hb0_A          156 NVKRRYDTTYGTYTINITVNLTDK  179 (369)
T ss_dssp             EEEETTSCEEEEEEEEEEEEEECG
T ss_pred             EECCCCCCCCEEEEEEEEEECCCC
T ss_conf             702578875336899889973147


No 13 
>1khi_A HEX1; membrane sealing, peroxisomal target, structural protein; 1.78A {Neurospora crassa} SCOP: b.34.5.2 b.40.4.5
Probab=26.61  E-value=29  Score=14.46  Aligned_cols=64  Identities=19%  Similarity=0.169  Sum_probs=35.0

Q ss_pred             EEEEEEECCCCCEEEEEEEECCC---CEEEEECCCC--CCCCCE-----------EEEEECCCCCEEEEEEEECCCCCEE
Q ss_conf             70579946898302699987568---5499942788--767974-----------9999955443769999930898389
Q gi|254780885|r   23 LKGRFLLFDGTEYNCIVREISPG---GLCIVCDVPM--FLVGER-----------SIVFVEKVGRIEGKVVNFDSNRGYA   86 (207)
Q Consensus        23 l~GR~ll~d~~E~~C~t~diSpg---g~~l~~~~~~--~~~Ger-----------vv~Yld~iGrlEG~V~r~~~~~GFa   86 (207)
                      ..|-.|+-   ++||.+++||..   |=-=-+...+  ...-|-           ...++..+-|-|..+..+. + ||+
T Consensus        42 kGgyv~Ik---g~PCKVveisTS~KtGKHGhak~dIft~~~~e~~~k~~~~~Ps~~~~~vP~v~r~eyqlldI~-d-g~l  116 (176)
T 1khi_A           42 LGDILILQ---GRPCQVIRISTSAATGQHRYLGVDLFTKQLHEESSFVSNPAPSVVVQTMLGPVFKQYRVLDMQ-D-GSI  116 (176)
T ss_dssp             TTCEEEET---TEEEEEEEEEECTTTCCEEEEEEETTTCCEEEEECCEECSSTTCCEEEEEEECCEEEEEEEEE-T-TEE
T ss_pred             CCCEEEEC---CCCEEEEEEECCCCCCCCCEEEEEEEEEEEEECCCCCCCCCCCCCEEECCCEEEEEEEEEEEE-C-CCE
T ss_conf             08899998---810689988627889845468899986116743664347579973026674366157999981-8-928


Q ss_pred             EEEEC
Q ss_conf             99976
Q gi|254780885|r   87 VRIVT   91 (207)
Q Consensus        87 v~l~~   91 (207)
                      .-+.-
T Consensus       117 sLMd~  121 (176)
T 1khi_A          117 VAMTE  121 (176)
T ss_dssp             EEECT
T ss_pred             EEECC
T ss_conf             99837


Done!