Query         gi|254780885|ref|YP_003065298.1| hypothetical protein CLIBASIA_03910 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 207
No_of_seqs    61 out of 63
Neff          4.3 
Searched_HMMs 13730
Date          Wed Jun  1 10:24:25 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780885.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1ywua1 b.45.2.1 (A:1-125) Hyp  98.6 2.2E-07 1.6E-11   62.7  10.1   93   12-107     7-105 (125)
  2 d1ywua1 b.45.2.1 (A:1-125) Hyp  98.5 3.9E-07 2.9E-11   61.2   9.9   77  113-193     4-91  (125)
  3 d2rdea1 b.45.2.1 (A:138-247) H  85.3     1.1 7.9E-05   21.8   9.2   78   17-96      2-92  (110)
  4 d1gtta2 d.177.1.1 (A:214-429)   38.3      11  0.0008   15.6   4.8   13   84-96     88-100 (216)
  5 d1khia1 b.34.5.2 (A:27-102) Wo  29.9      14 0.00099   15.0   2.1   10   34-43     24-33  (76)
  6 d1lfba_ a.4.1.1 (A:) Hepatocyt  27.4      17  0.0012   14.5   2.2   14   91-104    22-35  (78)
  7 d1x6oa1 b.34.5.2 (A:19-86) Euk  24.6      19  0.0014   14.2   2.1   12   33-44     19-30  (68)
  8 d1go3e1 b.40.4.5 (E:79-184) C-  22.7      21  0.0015   13.9   2.1   63   72-152     7-74  (106)
  9 d1sawa_ d.177.1.1 (A:) FAHD1 (  22.0      21  0.0015   13.9   4.0   88   84-174    89-187 (217)
 10 d1s21a_ d.166.1.4 (A:) AvrPphF  20.3      19  0.0014   14.1   1.4   17  132-148   160-176 (176)

No 1  
>d1ywua1 b.45.2.1 (A:1-125) Hypothetical protein PA4608 {Pseudomonas aeruginosa [TaxId: 287]}
Probab=98.60  E-value=2.2e-07  Score=62.72  Aligned_cols=93  Identities=13%  Similarity=0.106  Sum_probs=53.6

Q ss_pred             HHCCCEEEEEEEEEEEEECCCCCEEEEEEEECCCCEEEEECCCC-CCCCCEEEEEE----CCCCCEEEEEEEECCCCCEE
Q ss_conf             01062147999705799468983026999875685499942788-76797499999----55443769999930898389
Q gi|254780885|r   12 DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPM-FLVGERSIVFV----EKVGRIEGKVVNFDSNRGYA   86 (207)
Q Consensus        12 drR~f~RV~v~l~GR~ll~d~~E~~C~t~diSpgg~~l~~~~~~-~~~Gervv~Yl----d~iGrlEG~V~r~~~~~GFa   86 (207)
                      |||+|.|+++.+++..... +..|.|.+.|+|.+|+.+.++.+. +..|+.+.++|    +..-.++|+|++...+ |..
T Consensus         7 erR~~~Rv~~~~~~~l~~~-~~~~~~~~~DiS~~G~~i~~~~~~~~~~~~~v~l~l~l~~~~~i~~~~~Vv~~~~~-~~G   84 (125)
T d1ywua1           7 ERRRFHRIAFDADSEILQG-ERRWEVLLHDVSLHGILVGQPQDWNGDPQRPFEARLYLGLDVLIRMEISLAWARDG-LLG   84 (125)
T ss_dssp             SSCCCCSSCCSCEEEEEET-TEEEEEEEEEECSSEEEEECSSCCCCCTTSEEEEEEESSSSCEEEEEEEEEEEETT-EEE
T ss_pred             CCCCCEEEEEEEEEEEEEC-CEEEEEEEEEECCCCEEEECCCCCCCCCCCEEEEEEECCCCCEEEEEEEEEEECCC-EEE
T ss_conf             2479867875207999999-99999999982178489974887788999879999986999599999999997499-999


Q ss_pred             EEEEC-CHHHHHHHHHHHHHHH
Q ss_conf             99976-9878999999999876
Q gi|254780885|r   87 VRIVT-SENERRKLADKLIWLA  107 (207)
Q Consensus        87 v~l~~-t~~kR~kLA~qLtWla  107 (207)
                      +.|.. ......+| ..|.|+-
T Consensus        85 l~f~~id~ds~~~L-r~li~~~  105 (125)
T d1ywua1          85 FECQHIDLDSISHL-RRLVELN  105 (125)
T ss_dssp             EEEEEECHHHHHHH-HHHHHHH
T ss_pred             EEEEECCHHHHHHH-HHHHHHH
T ss_conf             99986698999999-9999846


No 2  
>d1ywua1 b.45.2.1 (A:1-125) Hypothetical protein PA4608 {Pseudomonas aeruginosa [TaxId: 287]}
Probab=98.53  E-value=3.9e-07  Score=61.17  Aligned_cols=77  Identities=10%  Similarity=0.076  Sum_probs=61.9

Q ss_pred             CCCHHCCCCCCCCCCCCCEEEEEECCCCEEEEEEEEEECCCEEEECCCCCCC--CCEEEE---------CCEEEEEEEEE
Q ss_conf             7502102567477776513689957998898999987424204551577899--855897---------34669999993
Q gi|254780885|r  113 HLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEM--FSKVLF---------NDILGRVVRIF  181 (207)
Q Consensus       113 ~l~e~R~h~R~vPr~~~~~~~l~l~DG~~~~criiDiS~SGAAi~~~~rp~i--Gs~V~v---------G~~~grVVRh~  181 (207)
                      .-.|.|.+.|+.-..+   +.+.. +|..++|+++|+|+.|+.+.++...++  |..|++         -.+.|+|||..
T Consensus         4 ~~~erR~~~Rv~~~~~---~~l~~-~~~~~~~~~~DiS~~G~~i~~~~~~~~~~~~~v~l~l~l~~~~~i~~~~~Vv~~~   79 (125)
T d1ywua1           4 QHDERRRFHRIAFDAD---SEILQ-GERRWEVLLHDVSLHGILVGQPQDWNGDPQRPFEARLYLGLDVLIRMEISLAWAR   79 (125)
T ss_dssp             CCCSSCCCCSSCCSCE---EEEEE-TTEEEEEEEEEECSSEEEEECSSCCCCCTTSEEEEEEESSSSCEEEEEEEEEEEE
T ss_pred             CCCCCCCCEEEEEEEE---EEEEE-CCEEEEEEEEEECCCCEEEECCCCCCCCCCCEEEEEEECCCCCEEEEEEEEEEEC
T ss_conf             8432479867875207---99999-9999999999821784899748877889998799999869995999999999974


Q ss_pred             CCEEEEEECCCC
Q ss_conf             890899971677
Q gi|254780885|r  182 PGGIAIEFSSVQ  193 (207)
Q Consensus       182 ~~GfaVeF~~~q  193 (207)
                      ++|+|++|.++-
T Consensus        80 ~~~~Gl~f~~id   91 (125)
T d1ywua1          80 DGLLGFECQHID   91 (125)
T ss_dssp             TTEEEEEEEEEC
T ss_pred             CCEEEEEEEECC
T ss_conf             999999998669


No 3  
>d2rdea1 b.45.2.1 (A:138-247) Hypothetical protein VCA0042, C-terminal domain {Vibrio cholerae O395 [TaxId: 345073]}
Probab=85.33  E-value=1.1  Score=21.75  Aligned_cols=78  Identities=19%  Similarity=0.391  Sum_probs=53.9

Q ss_pred             EEEEEEEEEEEEECCCCCEEEEEEEECCCCEEEEECCCCC---CCCCEEEEEEC-------CCCCEEEEEEEECCC---C
Q ss_conf             1479997057994689830269998756854999427887---67974999995-------544376999993089---8
Q gi|254780885|r   17 QRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMF---LVGERSIVFVE-------KVGRIEGKVVNFDSN---R   83 (207)
Q Consensus        17 ~RV~v~l~GR~ll~d~~E~~C~t~diSpgg~~l~~~~~~~---~~Gervv~Yld-------~iGrlEG~V~r~~~~---~   83 (207)
                      .|-+|+|.||....|+ --.|-.+|+|-.|-+++.+ |++   .+|++|.+-+-       .+-.+-|.|-...--   .
T Consensus         2 ~RyEVnL~~rv~~~~~-~~~cEiRDLSksGCrFvt~-p~sr~~qvgd~v~l~v~~~~~g~~~~~PL~G~icnlQkS~hya   79 (110)
T d2rdea1           2 PRFELNLAGKVLFDEH-RGDCELRDLSRSGCRFITP-PLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKICNLQRSLHHA   79 (110)
T ss_dssp             CBEEEEEEEEEEETTE-EEEEEEEEECSSEEEEEEC-TTSCCCCTTCEEEEEEBSSTTSSCBCSCEEEEEEEEEECSSCE
T ss_pred             CCEEEECCEEEEEECE-EEEEEEEECCCCCCEEECC-CCCCCEECCCEEEEEEECCCCCCCCCCCCCCEEECCHHHHCCC
T ss_conf             6268730237887031-7577872045267658738-9998603187689999737889715377553022123220201


Q ss_pred             CEEEEEECCHHHH
Q ss_conf             3899997698789
Q gi|254780885|r   84 GYAVRIVTSENER   96 (207)
Q Consensus        84 GFav~l~~t~~kR   96 (207)
                      .+-|.|.--.+.-
T Consensus        80 ryGv~Fde~G~~n   92 (110)
T d2rdea1          80 RYGLEFNEEGRNN   92 (110)
T ss_dssp             EEEEEECHHHHHH
T ss_pred             CCCEEECHHHHHH
T ss_conf             0233564110666


No 4  
>d1gtta2 d.177.1.1 (A:214-429) 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase HpcE {Escherichia coli [TaxId: 562]}
Probab=38.25  E-value=11  Score=15.59  Aligned_cols=13  Identities=23%  Similarity=0.212  Sum_probs=8.9

Q ss_pred             CEEEEEECCHHHH
Q ss_conf             3899997698789
Q gi|254780885|r   84 GYAVRIVTSENER   96 (207)
Q Consensus        84 GFav~l~~t~~kR   96 (207)
                      ||.+....|.+..
T Consensus        88 Gy~i~nD~t~rd~  100 (216)
T d1gtta2          88 GYTVCNDYAIRDY  100 (216)
T ss_dssp             EEEEEECCEEGGG
T ss_pred             EEECCCCCCCHHH
T ss_conf             2510033541111


No 5  
>d1khia1 b.34.5.2 (A:27-102) Woronin body major protein (Hex1) {Filamentous fungi (Neurospora crassa) [TaxId: 5141]}
Probab=29.91  E-value=14  Score=15.03  Aligned_cols=10  Identities=40%  Similarity=0.458  Sum_probs=5.7

Q ss_pred             CEEEEEEEEC
Q ss_conf             3026999875
Q gi|254780885|r   34 EYNCIVREIS   43 (207)
Q Consensus        34 E~~C~t~diS   43 (207)
                      ++||++++||
T Consensus        24 g~PCkIv~is   33 (76)
T d1khia1          24 GRPCQVIRIS   33 (76)
T ss_dssp             TEEEEEEEEE
T ss_pred             CCCCEEEEEE
T ss_conf             8240899876


No 6  
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]}
Probab=27.41  E-value=17  Score=14.52  Aligned_cols=14  Identities=29%  Similarity=0.404  Sum_probs=11.5

Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             69878999999999
Q gi|254780885|r   91 TSENERRKLADKLI  104 (207)
Q Consensus        91 ~t~~kR~kLA~qLt  104 (207)
                      -|...|+.||..|.
T Consensus        22 Ps~~~Re~LA~~ln   35 (78)
T d1lfba_          22 PSKEERETLVEECN   35 (78)
T ss_dssp             CCHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHC
T ss_conf             99999999999966


No 7  
>d1x6oa1 b.34.5.2 (A:19-86) Eukaryotic initiation translation factor 5a (eIF5a) {Leishmania infantum [TaxId: 5671]}
Probab=24.59  E-value=19  Score=14.17  Aligned_cols=12  Identities=25%  Similarity=0.371  Sum_probs=7.3

Q ss_pred             CCEEEEEEEECC
Q ss_conf             830269998756
Q gi|254780885|r   33 TEYNCIVREISP   44 (207)
Q Consensus        33 ~E~~C~t~diSp   44 (207)
                      .+.||++++||-
T Consensus        19 ~g~PCkI~~ist   30 (68)
T d1x6oa1          19 NGRPCKVIDLSV   30 (68)
T ss_dssp             TTEEEEEEEEEE
T ss_pred             CCEEEEEEEEEE
T ss_conf             997469998753


No 8  
>d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]}
Probab=22.67  E-value=21  Score=13.94  Aligned_cols=63  Identities=25%  Similarity=0.229  Sum_probs=38.1

Q ss_pred             EEEEEEEECCCCCEEEEEECCHHHHHHHHHHHHHHHCCCCCCCCHHC-----CCCCCCCCCCCCEEEEEECCCCEEEEEE
Q ss_conf             76999993089838999976987899999999987642436750210-----2567477776513689957998898999
Q gi|254780885|r   72 IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCR-----AYGRKITRDREVDAQLVLNDNTKHSCKV  146 (207)
Q Consensus        72 lEG~V~r~~~~~GFav~l~~t~~kR~kLA~qLtWlanr~~l~l~e~R-----~h~R~vPr~~~~~~~l~l~DG~~~~cri  146 (207)
                      ++|.|+.+.+ .||-++++.           +..|-....+  ++++     .+.++..+.+    .-.+.-|..+.|+|
T Consensus         7 ~~g~V~~v~~-~G~FVel~~-----------ieGlv~~s~l--~~~~~~~~~~~~~~~~~~~----~~~~~~Gd~v~vkV   68 (106)
T d1go3e1           7 IEGEVVDVVE-FGSFVRLGP-----------LDGLIHVSQI--MDDYVSYDPKREAIIGKET----GKVLEIGDYVRARI   68 (106)
T ss_dssp             EEEEEEEEET-TEEEEECSS-----------SEEEEEGGGS--CSSCEEECCC--CEEETTT----CCEECTTCEEEEEE
T ss_pred             EEEEEEEEEE-EEEEEEEEC-----------EEEEEEEECC--CCCEEEECCCEEEEEECCC----CCCEEECCEEEEEE
T ss_conf             9999999960-389999608-----------6989980003--6760650101157860456----63223045699999


Q ss_pred             EEEECC
Q ss_conf             987424
Q gi|254780885|r  147 IDISES  152 (207)
Q Consensus       147 iDiS~S  152 (207)
                      +++.+-
T Consensus        69 ~~vd~~   74 (106)
T d1go3e1          69 VAISLK   74 (106)
T ss_dssp             EEEECC
T ss_pred             EEECHH
T ss_conf             998416


No 9  
>d1sawa_ d.177.1.1 (A:) FAHD1 (Flj36880, YISKL) {Human (Homo sapiens) [TaxId: 9606]}
Probab=22.03  E-value=21  Score=13.86  Aligned_cols=88  Identities=14%  Similarity=0.052  Sum_probs=35.6

Q ss_pred             CEEEEEECCHHHHHHH--HHHHHHHHCCC-CCCCC--HHCCCCCC-CCCCCCCEEEEEECCCCEEEEE-EEEEECCC---
Q ss_conf             3899997698789999--99999876424-36750--21025674-7777651368995799889899-99874242---
Q gi|254780885|r   84 GYAVRIVTSENERRKL--ADKLIWLANKD-DLHLQ--DCRAYGRK-ITRDREVDAQLVLNDNTKHSCK-VIDISESG---  153 (207)
Q Consensus        84 GFav~l~~t~~kR~kL--A~qLtWlanr~-~l~l~--e~R~h~R~-vPr~~~~~~~l~l~DG~~~~cr-iiDiS~SG---  153 (207)
                      ||.+....|.|-...-  ..-+-|...|. +-.-|  .--..+-+ -|.+  ..-++++ ||...+.- .-||.-|=   
T Consensus        89 Gyti~nDvt~Rd~q~~~~~~~~~~~~~K~~d~~~p~Gp~v~~d~~~d~~~--l~i~~~V-NGe~~Q~~~t~~mi~~~~el  165 (217)
T d1sawa_          89 GYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVPKEKIPDPHK--LKLWLKV-NGELRQEGETSSMIFSIPYI  165 (217)
T ss_dssp             EEEEEECCEEHHHHHHHHHHTCCSHHHHCSTTCEEECCCEETTSCSCTTS--CEEEEEE-TTEEEEEEEGGGBSSCHHHH
T ss_pred             CCEEEEEECHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEHHHCCCCCC--EEEEEEE-CCEEEEECCHHHHCCCHHHH
T ss_conf             52200011126777888634898652565667675146787888887433--2899999-99999807868732069999


Q ss_pred             -EEEECCCCCCCCCEEEECCEE
Q ss_conf             -045515778998558973466
Q gi|254780885|r  154 -VSVSVDLQIEMFSKVLFNDIL  174 (207)
Q Consensus       154 -AAi~~~~rp~iGs~V~vG~~~  174 (207)
                       +-+|....+..|.-+..|.-.
T Consensus       166 i~~lS~~~tL~pGDvI~TGTP~  187 (217)
T d1sawa_         166 ISYVSKIITLEEGDIILTGTPK  187 (217)
T ss_dssp             HHHHHTTSCBCTTCEEECCCCS
T ss_pred             HHHHHCCCEECCCCEEECCCCC
T ss_conf             9998689667999489828989


No 10 
>d1s21a_ d.166.1.4 (A:) AvrPphF ORF2, a type III effector {Pseudomonas syringae pv. phaseolicola [TaxId: 319]}
Probab=20.30  E-value=19  Score=14.09  Aligned_cols=17  Identities=18%  Similarity=0.305  Sum_probs=14.8

Q ss_pred             EEEEECCCCEEEEEEEE
Q ss_conf             68995799889899998
Q gi|254780885|r  132 AQLVLNDNTKHSCKVID  148 (207)
Q Consensus       132 ~~l~l~DG~~~~criiD  148 (207)
                      ..+||+.|.+.|..|||
T Consensus       160 LIVTLPkGq~VPveii~  176 (176)
T d1s21a_         160 LIVTLPKGRKVPVNILD  176 (176)
T ss_dssp             EEEECCTTCEEECEECC
T ss_pred             EEEECCCCCCCCCEECC
T ss_conf             99986788813524059


Done!