BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780885|ref|YP_003065298.1| hypothetical protein
CLIBASIA_03910 [Candidatus Liberibacter asiaticus str. psy62]
         (207 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780885|ref|YP_003065298.1| hypothetical protein CLIBASIA_03910 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040562|gb|ACT57358.1| hypothetical protein CLIBASIA_03910 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 207

 Score =  420 bits (1080), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE 60
           MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE
Sbjct: 1   MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE 60

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAY 120
           RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAY
Sbjct: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAY 120

Query: 121 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI 180
           GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI
Sbjct: 121 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI 180

Query: 181 FPGGIAIEFSSVQESNIAFKSLINHCY 207
           FPGGIAIEFSSVQESNIAFKSLINHCY
Sbjct: 181 FPGGIAIEFSSVQESNIAFKSLINHCY 207


>gi|315122695|ref|YP_004063184.1| hypothetical protein CKC_04735 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496097|gb|ADR52696.1| hypothetical protein CKC_04735 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 195

 Score =  315 bits (807), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 174/193 (90%), Gaps = 2/193 (1%)

Query: 1   MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE 60
           MYRGIHNLQFIDQRAFQR+KVDLKGRFLLFDGTEY+C+VRE+SPGGLCI CDVP+ L+GE
Sbjct: 1   MYRGIHNLQFIDQRAFQRIKVDLKGRFLLFDGTEYDCVVREVSPGGLCIACDVPIVLIGE 60

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAY 120
           R IVFVEK+GRIEGKVVNFD  +GYAVRI++SE+ RRKLADKL+WLANKDDL LQD R Y
Sbjct: 61  RFIVFVEKIGRIEGKVVNFDIKKGYAVRIISSEDNRRKLADKLVWLANKDDLSLQDHRKY 120

Query: 121 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI 180
            RKI++D  V+AQL L + T HSC+VIDISESGVSVSVDL I++FSKV FNDILGRVVR 
Sbjct: 121 SRKISQD--VEAQLTLENKTVHSCQVIDISESGVSVSVDLHIKIFSKVFFNDILGRVVRN 178

Query: 181 FPGGIAIEFSSVQ 193
           FPGG+AIEF+++Q
Sbjct: 179 FPGGVAIEFATIQ 191


>gi|254504045|ref|ZP_05116196.1| Type IV pilus assembly protein PilZ [Labrenzia alexandrii DFL-11]
 gi|222440116|gb|EEE46795.1| Type IV pilus assembly protein PilZ [Labrenzia alexandrii DFL-11]
          Length = 212

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 122/194 (62%), Gaps = 4/194 (2%)

Query: 4   GIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSI 63
           G  +LQ  D+R  QRV+V++ GRF+L D  EY C V ++SPGG+ ++  V    VGER +
Sbjct: 12  GSKSLQVTDRRRHQRVQVNILGRFMLEDRREYPCQVIDMSPGGMAMITPVS-GKVGERVV 70

Query: 64  VFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRK 123
            +++ + R+EG++       G+AV +  +  +R K+A+ L WLAN+D+L+L + R + R 
Sbjct: 71  AYLDHLSRVEGRISRLIDG-GFAVELRNTVRKRDKIANVLTWLANRDELNLPEDRRHDRF 129

Query: 124 ITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPG 183
           + +++    +++L D T+H C++ D+S SG +++ D+  EM  ++    +  RVVR   G
Sbjct: 130 VPKNQMT--KMILPDGTEHVCRIFDVSLSGAAIATDILPEMGDQITLGKMRARVVRQIEG 187

Query: 184 GIAIEFSSVQESNI 197
           GIA+EF++VQ   +
Sbjct: 188 GIAVEFAAVQSREL 201


>gi|307945505|ref|ZP_07660841.1| type IV pilus assembly PilZ [Roseibium sp. TrichSKD4]
 gi|307771378|gb|EFO30603.1| type IV pilus assembly PilZ [Roseibium sp. TrichSKD4]
          Length = 216

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 121/198 (61%), Gaps = 6/198 (3%)

Query: 6   HNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVF 65
             LQ +D+R  QRVKV++ GR++L D  EY C V ++SPGG+ ++  V    VGER + +
Sbjct: 15  RTLQALDKRRHQRVKVNILGRYMLEDRREYPCQVIDMSPGGMALIAPVS-GQVGERIVAY 73

Query: 66  VEKVGRIEGKVV-NFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKI 124
           ++++ R+EGK+   FD   G+AV +  S  +R K+A  L WLANK+ L L + R + R I
Sbjct: 74  LDQMSRVEGKITRTFDG--GFAVELRNSVRKRDKIASILTWLANKEALDLPEDRRHDRFI 131

Query: 125 TRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGG 184
            ++     ++ L D T+H+C++ D+S SG ++S DL +E    +    +  RVVR   GG
Sbjct: 132 PKN--TLTRIKLPDGTEHTCRISDLSLSGAAISTDLDVEAGDAIEIGKMSARVVRRIEGG 189

Query: 185 IAIEFSSVQESNIAFKSL 202
           IA+EF  VQ  ++  +++
Sbjct: 190 IAVEFGEVQNRDLLERTI 207


>gi|118591266|ref|ZP_01548665.1| type IV pilus assembly PilZ [Stappia aggregata IAM 12614]
 gi|118436342|gb|EAV42984.1| type IV pilus assembly PilZ [Stappia aggregata IAM 12614]
          Length = 213

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 120/194 (61%), Gaps = 4/194 (2%)

Query: 4   GIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSI 63
           G  +LQ  D+R  QRV+V++ GRF+L D  EY C V ++SPGG+ ++  V    VGER I
Sbjct: 13  GSRSLQVTDRRRHQRVQVNILGRFMLEDRREYPCQVIDMSPGGMAMITPV-TGRVGERVI 71

Query: 64  VFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRK 123
            +++ + R+EG +       G+AV +  +  +R K+A+ L WLAN+D+L+L + R + R 
Sbjct: 72  AYLDHLSRVEGTISRLIDG-GFAVELRNTVRKRDKIANVLTWLANRDELNLPEDRRHDRF 130

Query: 124 ITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPG 183
           + ++     +++L D ++H C++ID+S SG +++ D+  EM   +    +  RV+R   G
Sbjct: 131 VPKNPMT--KMILPDGSEHVCRIIDVSLSGAAIATDILPEMGDPITLGKMHARVIRRIEG 188

Query: 184 GIAIEFSSVQESNI 197
           GIA+EF++VQ   +
Sbjct: 189 GIAVEFAAVQSREL 202


>gi|222086060|ref|YP_002544592.1| hypothetical protein Arad_2484 [Agrobacterium radiobacter K84]
 gi|221723508|gb|ACM26664.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 209

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 113/182 (62%), Gaps = 4/182 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           DQR FQRV ++++GR +L    EY C+V E+SPG + + C +      ER + +++ +GR
Sbjct: 23  DQRTFQRVPINMQGRLMLASYEEYECLVTEMSPGDMYVTC-LGRPRANERIVAYIDHLGR 81

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG VV  D  RG+++ I  ++ +R KLA +L WLANK +L L + R + R   R     
Sbjct: 82  VEGNVVAVD-GRGFSMSINATDRKREKLAAQLTWLANKHELGLPEDRRHDRLTPRS--TT 138

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           ++L L D T + C+++D+S SG +V V+ +  + + V   ++ GRVVR F  G+AIEF S
Sbjct: 139 SELTLEDGTLYVCRIMDLSLSGAAVDVEARPPIGTPVRLGNMRGRVVRHFMEGVAIEFLS 198

Query: 192 VQ 193
           +Q
Sbjct: 199 LQ 200


>gi|222148624|ref|YP_002549581.1| hypothetical protein Avi_2200 [Agrobacterium vitis S4]
 gi|221735610|gb|ACM36573.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 203

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 116/181 (64%), Gaps = 4/181 (2%)

Query: 13  QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRI 72
           QRAFQRV V L+GR ++    EY C+  ++SPG + ++C     + GER I +++ +GRI
Sbjct: 18  QRAFQRVSVSLEGRLMVPSEDEYVCLTVDMSPGDVRVICAA-RPVPGERIIAYIDHIGRI 76

Query: 73  EGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDA 132
           EG V+   ++ G+ + IV +E +R KLA +L W+ANK +L L + R + R   +  +   
Sbjct: 77  EGTVIK-TTDDGFVISIVATERKREKLAAQLTWIANKHELGLPEDRRHDRLTPK--QPRT 133

Query: 133 QLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSV 192
           +LV +D  K+SC+++D+S SG ++ +D++  + + V    + GRVVR F  G+AIEF+++
Sbjct: 134 ELVFDDGRKYSCRIMDLSLSGAAIDIDIRPPLGTAVRLGSMRGRVVRHFLEGVAIEFTTL 193

Query: 193 Q 193
           Q
Sbjct: 194 Q 194


>gi|146339954|ref|YP_001205002.1| hypothetical protein BRADO2958 [Bradyrhizobium sp. ORS278]
 gi|146192760|emb|CAL76765.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 202

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 113/182 (62%), Gaps = 4/182 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R FQRVKV L GR++L D  EY C V  +SPGGL ++    +  VG+R I +++ +GR
Sbjct: 13  ERRRFQRVKVHLLGRYMLPDRREYPCQVINMSPGGLALLAPG-IGNVGDRVIAYLDHIGR 71

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EGK+     N G+A+ I  +  +R KLA +L WLAN+D L+L + R + R I R+    
Sbjct: 72  VEGKITRIIDN-GFAMTIGATARKRDKLAAQLTWLANRDILNLPEDRRHDRIIPRN--PI 128

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           A L L D TK +C++ID+S SG +++ + +  M S+V+   +  RV+R   GG AIEF  
Sbjct: 129 AVLTLEDGTKMTCRIIDMSLSGAAIAAETKPAMKSQVMLGRVQARVIRNLEGGFAIEFMH 188

Query: 192 VQ 193
            Q
Sbjct: 189 PQ 190


>gi|209549449|ref|YP_002281366.1| type IV pilus assembly PilZ [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209535205|gb|ACI55140.1| type IV pilus assembly PilZ [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 203

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 114/182 (62%), Gaps = 4/182 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           +Q  FQRV ++++GR +L    E+ C+V ++SPG + + C +      ER + +++ +GR
Sbjct: 17  EQGVFQRVPINMQGRLMLASYEEFECMVIDMSPGDMYVTC-LGRPRTNERVVAYIDHLGR 75

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG V   D  RG+ + I  +E +R KLA +L WLANK +L L + R + R   RD   +
Sbjct: 76  VEGYVQTLD-GRGFTMSINATERKREKLAAQLTWLANKHELGLPEDRRHDRLTPRD--TN 132

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
            +L L D T+++C+++D+S SG +V V+++  + + V   ++ GRVVR F  G+AIEF S
Sbjct: 133 TELTLEDGTRYTCRIMDLSLSGAAVDVEMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLS 192

Query: 192 VQ 193
           +Q
Sbjct: 193 IQ 194


>gi|218462807|ref|ZP_03502898.1| hypothetical protein RetlK5_26662 [Rhizobium etli Kim 5]
          Length = 203

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 69/182 (37%), Positives = 115/182 (63%), Gaps = 4/182 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           +Q  FQRV ++++GR +L +  E+ C+V ++SPG + + C        ER + +++ +GR
Sbjct: 17  EQGVFQRVPINMQGRLMLANYEEFECMVIDMSPGDMYVTCSG-RPRANERVVAYIDHLGR 75

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG V   D  RG+ + I  +E +R KLA +L WLANK +L L + R + R   RD  V 
Sbjct: 76  VEGYVQMLD-GRGFTMSINATERKREKLAAQLTWLANKHELGLPEDRRHDRLTPRD--VK 132

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
            +L L+D T+++C+++D+S SG +V V+++  + + V   ++ GRVVR F  G+AIEF S
Sbjct: 133 TELTLDDGTRYACRIMDLSLSGAAVDVEMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLS 192

Query: 192 VQ 193
           +Q
Sbjct: 193 IQ 194


>gi|190891887|ref|YP_001978429.1| hypothetical protein RHECIAT_CH0002296 [Rhizobium etli CIAT 652]
 gi|190697166|gb|ACE91251.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 203

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 115/182 (63%), Gaps = 4/182 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           +Q  FQRV ++++GR +L +  E+ C+V ++SPG + + C        ER + +++ +GR
Sbjct: 17  EQGVFQRVPINMQGRLMLANYEEFECMVIDMSPGDMYVTCPG-RPRANERVVAYIDHLGR 75

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG V   D  RG+ + I  +E +R KLA +L WLANK +L L + R + R   RD  + 
Sbjct: 76  VEGYVQTLD-GRGFTMSINATERKREKLAAQLTWLANKHELGLPEDRRHDRLTPRD--IK 132

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
            +L L+D T+++C+++D+S SG ++ V+++  + + V   ++ GRVVR F  G+AIEF S
Sbjct: 133 TELTLDDGTRYACRIMDLSLSGAAIDVEMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLS 192

Query: 192 VQ 193
           +Q
Sbjct: 193 IQ 194


>gi|148256529|ref|YP_001241114.1| hypothetical protein BBta_5217 [Bradyrhizobium sp. BTAi1]
 gi|146408702|gb|ABQ37208.1| hypothetical protein BBta_5217 [Bradyrhizobium sp. BTAi1]
          Length = 202

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 113/182 (62%), Gaps = 4/182 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R FQRVKV L GR++L D  E+ C V  +SPGGL ++    +  VG+R I +++ +GR
Sbjct: 13  ERRRFQRVKVHLLGRYMLPDRREFPCQVINMSPGGLALLAPG-IGNVGDRVIAYLDHIGR 71

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EGK+     N G+A+ I  +  +R KLA +L WLAN+D L+L + R + R I R+    
Sbjct: 72  VEGKITRIIDN-GFAMTIGATARKRDKLAAQLTWLANRDILNLPEDRRHDRIIPRN--PI 128

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           A L L D TK +C++ID+S SG +++ + +  M S+V+   +  RVVR   GG AIEF  
Sbjct: 129 AVLTLEDGTKMTCRIIDMSLSGAAIAAETRPPMKSQVMLGRVQARVVRNLEGGFAIEFVH 188

Query: 192 VQ 193
            Q
Sbjct: 189 PQ 190


>gi|116252283|ref|YP_768121.1| hypothetical protein RL2537 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256931|emb|CAK08025.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 203

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 114/182 (62%), Gaps = 4/182 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           +Q  FQRV ++++GR +L +  E+ C+V ++SPG + + C +      ER + +++ +GR
Sbjct: 17  EQGVFQRVPINMQGRLMLANYEEFECMVIDMSPGDMYVTC-LGRPRANERVVAYIDHLGR 75

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG V   D  RG+ + I  ++ +R KLA +L WLANK +L L + R + R   RD    
Sbjct: 76  VEGYVQTID-GRGFTMSINATDRKREKLAAQLTWLANKHELGLPEDRRHDRLTPRD--TK 132

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
            +L L D T++SC+++D+S SG +V V+++  + + V   ++ GRVVR F  G+AIEF S
Sbjct: 133 TELTLEDGTRYSCRIMDLSLSGAAVDVEMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLS 192

Query: 192 VQ 193
           +Q
Sbjct: 193 IQ 194


>gi|241204776|ref|YP_002975872.1| type IV pilus assembly PilZ [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240858666|gb|ACS56333.1| type IV pilus assembly PilZ [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 203

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/182 (37%), Positives = 114/182 (62%), Gaps = 4/182 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           +Q  FQRV ++++GR +L +  E+ C+V ++SPG + + C +      ER + +++ +GR
Sbjct: 17  EQGVFQRVPINMQGRLMLANYEEFECMVIDMSPGDMYVTC-LGRPRANERVVAYIDHLGR 75

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG V   D  RG+ + I  ++ +R KLA +L WLANK +L L + R + R   RD + D
Sbjct: 76  VEGYVQTID-GRGFTMSINATDRKREKLAAQLTWLANKHELGLPEDRRHDRLTPRDTKTD 134

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
             L L D T +SC+++D+S SG +V V+++  + + V   ++ GRVVR F  G+AIEF S
Sbjct: 135 --LTLEDGTLYSCRIMDLSLSGAAVDVEMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLS 192

Query: 192 VQ 193
           +Q
Sbjct: 193 IQ 194


>gi|115524336|ref|YP_781247.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisA53]
 gi|115518283|gb|ABJ06267.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisA53]
          Length = 222

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 114/182 (62%), Gaps = 4/182 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R FQRVK+ L GR++L D  E+ C V ++SPGGL ++    +  VG+R I +++ +GR
Sbjct: 33  ERRRFQRVKLHLLGRYMLPDRREFPCQVIDMSPGGLAMLAPG-IGNVGDRVIAYLDHIGR 91

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EGK+     N G+A+ +  +  +R KLA +L WLAN+D L+L + R + R + R+    
Sbjct: 92  VEGKITRIIDN-GFAMTVGATPRKRDKLAAQLTWLANRDILNLPEDRRHDRLVPRN--PI 148

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           A L + D +KHSC++ID+S SG ++S + +  + ++VL   +  RVVR    G A+EF  
Sbjct: 149 AMLSMQDGSKHSCRIIDMSRSGAAISAEFRPPLQAEVLLGRVQARVVRHLEDGFALEFVH 208

Query: 192 VQ 193
            Q
Sbjct: 209 EQ 210


>gi|254470288|ref|ZP_05083692.1| type IV pilus assembly PilZ [Pseudovibrio sp. JE062]
 gi|211960599|gb|EEA95795.1| type IV pilus assembly PilZ [Pseudovibrio sp. JE062]
          Length = 211

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 121/194 (62%), Gaps = 9/194 (4%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           D+R F RV++++ GRF+L +  EY C V  +SPGG   +  V M  +GER + +++ +GR
Sbjct: 19  DRRRFSRVEINVLGRFMLENRREYPCQVVNMSPGGAAFISPV-MGEIGERVVAYLDHIGR 77

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EGK+V  + + G+A+ +  S  +R KLA  L WLANKD+L+L + R + R + ++    
Sbjct: 78  VEGKIVR-EIDGGFAMTVNASARKRDKLASVLTWLANKDELNLPEDRRFDRFVPKNPMT- 135

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
            +++L D  +++C+++D+S SG ++  D++  + + +    +  R+VR F  GIA+EF++
Sbjct: 136 -KIILPDGREYACRIVDVSLSGAALKTDVRPALGTPITLGKMRARIVRHFEEGIAVEFAT 194

Query: 192 VQESNIAFKSLINH 205
           VQ      K L+ H
Sbjct: 195 VQN-----KELLEH 203


>gi|85715638|ref|ZP_01046618.1| hypothetical protein NB311A_18356 [Nitrobacter sp. Nb-311A]
 gi|85697577|gb|EAQ35454.1| hypothetical protein NB311A_18356 [Nitrobacter sp. Nb-311A]
          Length = 202

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/193 (38%), Positives = 118/193 (61%), Gaps = 7/193 (3%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           I NL   ++R FQRVK+ L GR++L D  E+ C V  +SPGGL ++    +  VG+R + 
Sbjct: 7   ISNLP-AERRRFQRVKIHLLGRYMLPDRREFPCQVINMSPGGLAMLAPG-IGNVGDRVVA 64

Query: 65  FVEKVGRIEGKVVNF-DSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRK 123
           +++ +GR+EGKV    DS  G+A+ I  +  +R KLA +L WLAN+D L+L + R + R 
Sbjct: 65  YLDHIGRVEGKVTRIIDS--GFAMNISATPRKRDKLASQLTWLANRDILNLPEDRRHDRI 122

Query: 124 ITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPG 183
           + R+    A L L D T+ +C+++D+S+SG +VS + +  + S+V    +L RVVR    
Sbjct: 123 VPRN--PVANLTLEDGTQLTCRILDLSKSGAAVSAEKRPPLRSRVALGKVLARVVRYLEE 180

Query: 184 GIAIEFSSVQESN 196
           G A+EF   Q  +
Sbjct: 181 GFALEFIHEQHPD 193


>gi|75676353|ref|YP_318774.1| hypothetical protein Nwi_2168 [Nitrobacter winogradskyi Nb-255]
 gi|74421223|gb|ABA05422.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 214

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 118/193 (61%), Gaps = 7/193 (3%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           I NL  +++R FQRV+V L GR++L D  E+ C V  +SPGGL ++    +  VG+R IV
Sbjct: 19  ISNLP-VERRRFQRVRVHLLGRYMLPDRREFPCQVINMSPGGLAMLAPG-IGHVGDRVIV 76

Query: 65  FVEKVGRIEGKVVNF-DSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRK 123
           +++ +GR+EG++    DS  G+A+ I  +  +R KLA +L WLAN+D L+L + R + R 
Sbjct: 77  YLDHIGRVEGRITRIIDS--GFAMNISATPRKRDKLASQLTWLANRDILNLPEDRRHDRI 134

Query: 124 ITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPG 183
           + R+    A L L D T+ +C++ID+S SG +VS +    + S+V    +L RVVR    
Sbjct: 135 MPRN--PIAILTLEDGTRMTCRIIDLSMSGAAVSAEKTPPLQSRVALGKVLSRVVRNLEE 192

Query: 184 GIAIEFSSVQESN 196
           G A+EF   Q  +
Sbjct: 193 GFALEFIHEQHPD 205


>gi|316933323|ref|YP_004108305.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris DX-1]
 gi|315601037|gb|ADU43572.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris DX-1]
          Length = 203

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 113/179 (63%), Gaps = 4/179 (2%)

Query: 11  IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
           +++R FQRVKV L GR++L D  E+ C V  +SPGGL ++    +  VG+R I +++ VG
Sbjct: 13  LERRRFQRVKVHLLGRYMLPDRREFPCQVINMSPGGLAMLAPG-IGNVGDRVIAYLDHVG 71

Query: 71  RIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREV 130
           R+EGK+     N G+A+ +  +  +R KLA +L WLAN+D L+L + R + R + R+   
Sbjct: 72  RVEGKITRIIDN-GFAMTLAATPRKRDKLAAQLTWLANRDILNLPEDRRHDRIVPRN--P 128

Query: 131 DAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
            A L L+D ++ SC++ID+S SG +++ + +  + ++VL   +  RVVR    G A+EF
Sbjct: 129 IAILTLDDGSRMSCRIIDMSRSGAAIAAEHRPPLHAQVLLGRVASRVVRHLDDGFALEF 187


>gi|192292269|ref|YP_001992874.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris TIE-1]
 gi|192286018|gb|ACF02399.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris TIE-1]
          Length = 203

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 114/183 (62%), Gaps = 4/183 (2%)

Query: 11  IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
           +++R FQRVKV L GR++L D  E+ C V  +SPGGL ++    +  VG+R I +++ VG
Sbjct: 13  LERRRFQRVKVHLLGRYMLPDRREFPCQVINMSPGGLALLAPG-IGNVGDRVIAYLDHVG 71

Query: 71  RIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREV 130
           R+EGK+     N G+A+ +  +  +R KLA +L WLAN+D L+L + R + R + R+   
Sbjct: 72  RVEGKITRIIDN-GFAMTVAATPRKRDKLAAQLTWLANRDILNLPEDRRHDRIVPRN--P 128

Query: 131 DAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFS 190
            A L L+D ++ SC++ID+S SG +++ + +  + ++VL   +  RVVR    G A+EF 
Sbjct: 129 IAVLTLDDGSRMSCRIIDMSRSGAAIAAEQRPPLNAQVLLGRVASRVVRHLDDGFALEFV 188

Query: 191 SVQ 193
             Q
Sbjct: 189 HEQ 191


>gi|27380679|ref|NP_772208.1| hypothetical protein blr5568 [Bradyrhizobium japonicum USDA 110]
 gi|27353844|dbj|BAC50833.1| blr5568 [Bradyrhizobium japonicum USDA 110]
          Length = 205

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 118/198 (59%), Gaps = 8/198 (4%)

Query: 1   MYRGIHNLQFI----DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMF 56
           M   + N +F+    ++R FQRVKV L GR++L D  E+ C V  +SPGGL ++    + 
Sbjct: 1   MKMALANKKFLPAAEERRRFQRVKVHLLGRYMLPDRREFPCQVINMSPGGLALLAPG-IG 59

Query: 57  LVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQD 116
            VG+R + +++ +GR+EGK+     N G+A+ I  +  +R KLA +L WLAN+D L+L +
Sbjct: 60  NVGDRVVAYLDHIGRVEGKITRIIDN-GFAMTIGATPRKRDKLAAQLTWLANRDILNLPE 118

Query: 117 CRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGR 176
            R + R + R+    A L L D TK +C++ID+S SG +++ + +  + S VL   + GR
Sbjct: 119 DRRHDRIVPRN--PIAVLTLEDGTKMTCRIIDLSLSGAAIAAENRPPLKSIVLLGRVQGR 176

Query: 177 VVRIFPGGIAIEFSSVQE 194
           VVR    G A+EF   Q 
Sbjct: 177 VVRNLEDGFALEFMHEQP 194


>gi|90424624|ref|YP_532994.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisB18]
 gi|90106638|gb|ABD88675.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisB18]
          Length = 204

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 110/178 (61%), Gaps = 4/178 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R FQRVKV L GR++L D  E+ C V  +SPGGL ++    +  VG+R I +++ +GR
Sbjct: 15  ERRRFQRVKVHLLGRYMLPDRREFPCQVINMSPGGLAMLAPG-IGNVGDRVIAYLDHIGR 73

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EGK+     N G+A+ +  +  +R KLA +L WLAN+D L+L + R + R + R+    
Sbjct: 74  VEGKITRIIDN-GFAMTVGATPRKRDKLAAQLTWLANRDILNLPEDRRHDRIVPRN--PI 130

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
           + L L D +K SC++ID+S SG ++S D +  + S+V    +  RVVR    G A+EF
Sbjct: 131 SILTLEDGSKQSCRIIDMSRSGAAISADFRPTLNSQVALGRVQARVVRHLDDGFALEF 188


>gi|220924974|ref|YP_002500276.1| type IV pilus assembly PilZ [Methylobacterium nodulans ORS 2060]
 gi|219949581|gb|ACL59973.1| type IV pilus assembly PilZ [Methylobacterium nodulans ORS 2060]
          Length = 209

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 112/186 (60%), Gaps = 4/186 (2%)

Query: 4   GIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSI 63
           G+   +  D+R   RV + L GR++L D  EY C   +ISPGG+ +VC VP   +GER +
Sbjct: 13  GLLAARVADRRRHHRVAIALLGRYMLADRREYPCQTVDISPGGVRLVCAVPGE-IGERVV 71

Query: 64  VFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRK 123
           +++E +GR+EG +     + G+AV +  + ++R K+A +L WLAN+  L L + R + R 
Sbjct: 72  IYLEHLGRLEGTISRILPD-GFAVALSATPHKREKIASQLTWLANRASLGLPEDRRHERV 130

Query: 124 ITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPG 183
           + R   V   L L+D ++   ++ID+S SG +++ DL + + S +L      RVVR F G
Sbjct: 131 VPRQSAV--TLRLDDGSEVPARLIDVSLSGAALACDLPLPVDSPLLIGRTACRVVRQFKG 188

Query: 184 GIAIEF 189
           G+A+EF
Sbjct: 189 GLAVEF 194


>gi|319783235|ref|YP_004142711.1| type IV pilus assembly PilZ [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169123|gb|ADV12661.1| type IV pilus assembly PilZ [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 205

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/182 (37%), Positives = 115/182 (63%), Gaps = 4/182 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R FQRV+V + GRF+L D TE+ C V ++SPG +    D  + + GE+ I +++ +GR
Sbjct: 14  ERRNFQRVRVKIYGRFMLEDRTEHPCQVVDMSPGNVAFRTDR-IGMPGEKIIAYIDHIGR 72

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           IEG VV      G+A+ ++ S+ ++ KLA +L WLANK +L L + R + R   R+    
Sbjct: 73  IEG-VVTRTLQDGFAMTVIASDRKKDKLAAQLTWLANKHELDLPEDRRHERVAPRN--PT 129

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           + L L D  ++ C++ID+S SG +V +D++  +  +V+   + G+VVR F  G+AIEF+ 
Sbjct: 130 SVLQLTDGRQYQCRIIDLSLSGAAVEIDVKPAIGIQVMLGTMRGQVVRHFEDGVAIEFAV 189

Query: 192 VQ 193
           +Q
Sbjct: 190 IQ 191


>gi|92118084|ref|YP_577813.1| hypothetical protein Nham_2571 [Nitrobacter hamburgensis X14]
 gi|91800978|gb|ABE63353.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 202

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 114/187 (60%), Gaps = 6/187 (3%)

Query: 11  IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
           +++R FQRV+V L GR++L D  E+ C +  +SPGGL ++    +  VG+R +V+++ +G
Sbjct: 12  VERRRFQRVRVHLLGRYMLPDRREFPCQIINMSPGGLAMLAPG-IGNVGDRVVVYLDHIG 70

Query: 71  RIEGKVVNF-DSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDRE 129
           R+EGK+    DS  G+A+ +  +  +R +LA +L WLAN+D L+L + R + R + R   
Sbjct: 71  RVEGKITRIIDS--GFAMSVGATPRKRDRLAAQLTWLANRDILNLPEDRRHDRIVPR--S 126

Query: 130 VDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
               L L D T+ +C++ID+S SG ++S + +  + S+V    +L RVVR    G A+EF
Sbjct: 127 PITTLTLEDGTRMTCRIIDLSMSGAAISAETRPPLQSRVALGKVLARVVRNLEDGFALEF 186

Query: 190 SSVQESN 196
              Q  +
Sbjct: 187 VHEQHPD 193


>gi|13470468|ref|NP_102037.1| hypothetical protein mll0185 [Mesorhizobium loti MAFF303099]
 gi|14021210|dbj|BAB47823.1| mll0185 [Mesorhizobium loti MAFF303099]
          Length = 205

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 115/182 (63%), Gaps = 4/182 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R FQRV+V + GRF+L D TE+ C V ++SPG +    D  + + GE+ I +++ +GR
Sbjct: 14  ERRNFQRVRVKIYGRFMLEDRTEHPCQVVDMSPGNVAFRTDR-IGMPGEKVIAYIDHIGR 72

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           IEG VV      G+A+ ++ S+ ++ KLA +L WLANK +L L + R + R   R+    
Sbjct: 73  IEG-VVTRTLQDGFAMTVIASDRKKDKLAAQLTWLANKHELDLPEDRRHERVAPRN--PT 129

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           + L L D  ++ C++ID+S SG ++ +D++  +  +V+   + G++VR F  G+AIEF+ 
Sbjct: 130 SVLQLTDGRQYQCRIIDLSLSGAAIEIDVKPAIGVQVMLGTMRGQIVRHFEDGVAIEFAV 189

Query: 192 VQ 193
           +Q
Sbjct: 190 IQ 191


>gi|260460730|ref|ZP_05808980.1| type IV pilus assembly PilZ [Mesorhizobium opportunistum WSM2075]
 gi|259033307|gb|EEW34568.1| type IV pilus assembly PilZ [Mesorhizobium opportunistum WSM2075]
          Length = 205

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 114/182 (62%), Gaps = 4/182 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R FQRV+V + GRF+L D TE+ C V ++SPG +    D  + + GE+ I +++ +GR
Sbjct: 14  ERRNFQRVRVKIYGRFMLEDRTEHPCQVVDMSPGNVAFRTDR-IGMPGEKVIAYIDHIGR 72

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           IEG VV      G+A+ ++ S+ ++ KLA +L WLANK +L L + R + R   R+    
Sbjct: 73  IEG-VVTRTLQDGFAMTVIASDRKKDKLAAQLTWLANKHELDLPEDRRHERVAPRN--PT 129

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           + L L D  ++ C++ID+S SG +V +D++  +  +V    + G++VR F  G+AIEF+ 
Sbjct: 130 SVLQLTDGRQYQCRIIDLSLSGAAVEIDVKPAIGVQVTLGTMRGQIVRHFEDGVAIEFAV 189

Query: 192 VQ 193
           +Q
Sbjct: 190 IQ 191


>gi|170741419|ref|YP_001770074.1| type IV pilus assembly PilZ [Methylobacterium sp. 4-46]
 gi|168195693|gb|ACA17640.1| type IV pilus assembly PilZ [Methylobacterium sp. 4-46]
          Length = 209

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 72/181 (39%), Positives = 108/181 (59%), Gaps = 4/181 (2%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEK 68
           Q  D+R   RV V L GR++L D  EY C   +ISPGG+ +VC V    VGER+++++E 
Sbjct: 18  QASDRRRHHRVTVSLLGRYMLSDRREYPCQTVDISPGGVRLVCAV-TGEVGERTVIYLEH 76

Query: 69  VGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDR 128
           +GRIEG +     + G+AV I  + ++R K+A +L WLAN+  L L + R + R + R  
Sbjct: 77  LGRIEGTIARVLPD-GFAVAISATAHKREKIASQLTWLANRASLGLPEDRRHERVVPRQT 135

Query: 129 EVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIE 188
            V   L L+   +   ++ID+S SG +++ DL + + S +L      RVVR F GGIA+E
Sbjct: 136 AV--TLRLDTGVEVPARLIDVSLSGAALACDLPLAIDSALLVGRTPCRVVRQFRGGIAVE 193

Query: 189 F 189
           F
Sbjct: 194 F 194


>gi|150396264|ref|YP_001326731.1| type IV pilus assembly PilZ [Sinorhizobium medicae WSM419]
 gi|150027779|gb|ABR59896.1| type IV pilus assembly PilZ [Sinorhizobium medicae WSM419]
          Length = 202

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 109/182 (59%), Gaps = 6/182 (3%)

Query: 13  QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDV-PMFLVGERSIVFVEKVGR 71
           + AFQRV V+L GR +L    EY C   E+SPG +       P    GER I +V+ VGR
Sbjct: 17  ESAFQRVAVNLSGRLMLASHEEYACTAVEMSPGDVLFTSPARPRG--GERIIAYVDHVGR 74

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG V    S+  + +++  +E +R KLA +L W+ANK +L L + R + R   R  +V 
Sbjct: 75  LEGTVSRV-SDDAFVIQLNATERKREKLAAQLTWIANKHELGLPEDRRHDRLAPR--KVL 131

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
            +L ++   ++SC++ID+S SG +V VD++  + + V   ++ GR+VR F  G+AIEFS 
Sbjct: 132 TELSVDSGERYSCRIIDLSLSGAAVDVDIRPAIGAPVKLGNMKGRIVRHFQEGVAIEFSG 191

Query: 192 VQ 193
           +Q
Sbjct: 192 IQ 193


>gi|15965167|ref|NP_385520.1| hypothetical protein SMc00999 [Sinorhizobium meliloti 1021]
 gi|307309181|ref|ZP_07588852.1| type IV pilus assembly PilZ [Sinorhizobium meliloti BL225C]
 gi|307321511|ref|ZP_07600906.1| type IV pilus assembly PilZ [Sinorhizobium meliloti AK83]
 gi|15074347|emb|CAC45993.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306892818|gb|EFN23609.1| type IV pilus assembly PilZ [Sinorhizobium meliloti AK83]
 gi|306900327|gb|EFN30943.1| type IV pilus assembly PilZ [Sinorhizobium meliloti BL225C]
          Length = 202

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (59%), Gaps = 4/181 (2%)

Query: 13  QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRI 72
           + AFQRV V+L GR +L    EY+C   E+SPG + +         GER I +V+ VGR+
Sbjct: 17  ESAFQRVSVNLSGRLMLASHEEYDCTALEMSPGDVLLTSPA-RPRGGERIIAYVDHVGRL 75

Query: 73  EGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDA 132
           EG V    ++  + +++  +E +R KLA +L W+ANK +L L + R + R   R  +   
Sbjct: 76  EGTVSRV-ADDAFVIQLNATERKREKLAAQLTWIANKHELGLPEDRRHDRLAPR--KTLT 132

Query: 133 QLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSV 192
           +L ++   ++SC++ID+S SG +V +D +  + S V   ++ GR+VR F  G+AIEFS +
Sbjct: 133 ELTVDTGERYSCRIIDLSLSGAAVDIDTRPAVGSPVRLGNMKGRIVRHFQEGVAIEFSGI 192

Query: 193 Q 193
           Q
Sbjct: 193 Q 193


>gi|153009265|ref|YP_001370480.1| type IV pilus assembly PilZ [Ochrobactrum anthropi ATCC 49188]
 gi|151561153|gb|ABS14651.1| type IV pilus assembly PilZ [Ochrobactrum anthropi ATCC 49188]
          Length = 201

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 109/185 (58%), Gaps = 4/185 (2%)

Query: 11  IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
           + Q  F  V VDL GR++L + +E+ CI++ +SPG   ++  +     GER I +++ VG
Sbjct: 13  VRQENFNAVNVDLNGRYMLENRSEFPCIIKRMSPG-TALMSGIATPRNGERIIAYIDHVG 71

Query: 71  RIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREV 130
           RIEG + N  ++ G+ + + TSE ++ KL+ +L WLANK +L L + R + R +   R+ 
Sbjct: 72  RIEG-IANEVTSEGFHILLSTSEQKKDKLSAQLTWLANKHELALPEDRRHERVV--PRKT 128

Query: 131 DAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFS 190
              +   D  +  C++ D+S SG ++  + +  + S V+   I G VVR F GG AIEF+
Sbjct: 129 QQNITFADGAQRLCRIADLSLSGAAIESEFKPAIKSGVMLGPIRGTVVRHFQGGFAIEFA 188

Query: 191 SVQES 195
           ++Q S
Sbjct: 189 TIQTS 193


>gi|91977744|ref|YP_570403.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisB5]
 gi|91684200|gb|ABE40502.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisB5]
          Length = 203

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 111/182 (60%), Gaps = 4/182 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R FQRVK+ L GR++L D  E+ C V  +SPGGL ++    +  VG+R I +++ +GR
Sbjct: 14  ERRRFQRVKLHLLGRYMLPDRREFPCQVINMSPGGLAMLAPG-IGNVGDRVIAYLDHIGR 72

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EGK+     N G+A+ +  +  +R KLA +L WLAN+D L+L + R + R + R+    
Sbjct: 73  VEGKITRIIDN-GFAMTVGATPRKRDKLAAQLTWLANRDILNLPEDRRHDRIVPRN--PI 129

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           + L L D ++ +C++ID+S SG +++ + +  M S+V    +  RVVR    G A+EF  
Sbjct: 130 SLLTLQDGSRMTCRIIDMSRSGAAIAAEHRPPMNSQVSLGRVQARVVRYLEDGFALEFVH 189

Query: 192 VQ 193
            Q
Sbjct: 190 EQ 191


>gi|86749268|ref|YP_485764.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris HaA2]
 gi|86572296|gb|ABD06853.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 203

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/185 (36%), Positives = 113/185 (61%), Gaps = 6/185 (3%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R FQRVK+ L GR++L D  E+ C V  +SPGGL ++    +  VG+R I +++ +GR
Sbjct: 14  ERRRFQRVKIHLLGRYMLPDRREFPCQVINMSPGGLAMLAPG-IGNVGDRVIAYLDHIGR 72

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EGK+     N G+A+ +  +  +R KLA +L WLAN+D L+L + R + R + R+    
Sbjct: 73  VEGKITRIIDN-GFAMTVGATPRKRDKLAAQLTWLANRDILNLPEDRRHDRIVPRN--PI 129

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           + L L D ++ +C++ID+S SG +++ + +    ++VL   +  RVVR    G A+EF  
Sbjct: 130 SVLTLEDGSRMTCRIIDMSRSGAAIAAEQRPPTDTQVLLGRVAARVVRHLDDGFALEF-- 187

Query: 192 VQESN 196
           V E N
Sbjct: 188 VHEQN 192


>gi|299135313|ref|ZP_07028504.1| type IV pilus assembly PilZ [Afipia sp. 1NLS2]
 gi|298590290|gb|EFI50494.1| type IV pilus assembly PilZ [Afipia sp. 1NLS2]
          Length = 204

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 109/185 (58%), Gaps = 4/185 (2%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEK 68
           Q  ++R FQRVK+ L GR++L D  EY C    +SPGGL ++    +  +GER + +++ 
Sbjct: 11  QAEERRHFQRVKIHLLGRYMLSDRREYPCQAINMSPGGLALLAPG-IGNLGERVVAYLDH 69

Query: 69  VGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDR 128
           +GR+EGK+     N G+A+ +  +  +R KLA +L WLAN++ L+L + R + R + R+ 
Sbjct: 70  IGRVEGKITRLLDN-GFAMTVSATPRKREKLAAQLTWLANREILNLPEDRRHDRIVPRN- 127

Query: 129 EVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIE 188
                L L    +  C++ID+S SG ++S  ++ E+ S V+   +  RVVR    G AIE
Sbjct: 128 -AMGWLRLEGGGEMQCRIIDLSLSGAALSGQMRPEVGSHVMLGRVAARVVRHLEEGFAIE 186

Query: 189 FSSVQ 193
           F+  Q
Sbjct: 187 FNHPQ 191


>gi|23009259|ref|ZP_00050375.1| hypothetical protein Magn03004185 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 208

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 64/178 (35%), Positives = 107/178 (60%), Gaps = 4/178 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           DQR  QRV+  L GR++L D  EY C   ++SPGG+ + C V +  +GER +++++++GR
Sbjct: 20  DQRRHQRVRTTLLGRYMLADRREYPCQTVDMSPGGVRLTCAV-LGELGERVVLYLDQIGR 78

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG+VV      G+A+RI  +  +R K+A +L+W+AN++ L L + R+  R I     V 
Sbjct: 79  LEGEVVRHVPQ-GFAMRINATPRKREKIASQLMWIANRESLGLPEGRSQERLIPTQPGVT 137

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
             L L +      +++DIS SG +++   Q+ + + ++     GRVVR F GGI  +F
Sbjct: 138 --LRLENGNVIPARIVDISMSGAALATRSQVPIGTHLMVGSTPGRVVRHFEGGIGAQF 193


>gi|209884668|ref|YP_002288525.1| type IV pilus assembly PilZ [Oligotropha carboxidovorans OM5]
 gi|209872864|gb|ACI92660.1| type IV pilus assembly PilZ [Oligotropha carboxidovorans OM5]
          Length = 204

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 111/185 (60%), Gaps = 4/185 (2%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEK 68
           Q  ++R FQRV++ L GR++L D  EY C    +SPGGL ++    +  +GER + +++ 
Sbjct: 11  QAEERRRFQRVRIHLLGRYMLSDRREYPCQAINMSPGGLALLAPG-IGSIGERVVAYLDH 69

Query: 69  VGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDR 128
           +GR+EGK+     N G+A+ +  +  +R KLA +L WLAN++ L+L + R + R + R+ 
Sbjct: 70  IGRVEGKITRLLDN-GFAMTVNATPRKREKLAAQLTWLANREILNLPEDRRHDRIVPRN- 127

Query: 129 EVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIE 188
                L L+D ++  C++ID+S SG ++S  ++  + + V+   +  RVVR    G AIE
Sbjct: 128 -ASGLLKLSDGSEMPCRIIDLSLSGAALSGAMRPLVGTDVMLGRVAARVVRHLEEGFAIE 186

Query: 189 FSSVQ 193
           F+  Q
Sbjct: 187 FNHPQ 191


>gi|110634076|ref|YP_674284.1| type IV pilus assembly PilZ [Mesorhizobium sp. BNC1]
 gi|110285060|gb|ABG63119.1| type IV pilus assembly PilZ [Chelativorans sp. BNC1]
          Length = 202

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 110/184 (59%), Gaps = 4/184 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R FQRVK+ + GR++L D +E++C V ++SPG + +        VGER + +++ +GR
Sbjct: 15  ERRRFQRVKISIYGRYMLPDRSEHSCRVVDMSPGSVALKA-AQAGQVGERIVAYLDHIGR 73

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG +     + G+ + I  S+ +R KLA +L WLAN+ DL L + R Y R +T    + 
Sbjct: 74  VEGYLARIFED-GFEMTIKASQRKRDKLASQLTWLANRHDLDLPEDRRYER-VTPANPM- 130

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           + +   D  +H C+++D+S SG ++    +  + ++V   ++ GRV R F  G A+EFS 
Sbjct: 131 STIRTPDGYEHPCRIVDLSASGAAIETAPRPAIGTQVFLANLRGRVTRHFENGFALEFSL 190

Query: 192 VQES 195
           +QE 
Sbjct: 191 IQEP 194


>gi|188581467|ref|YP_001924912.1| type IV pilus assembly PilZ [Methylobacterium populi BJ001]
 gi|179344965|gb|ACB80377.1| type IV pilus assembly PilZ [Methylobacterium populi BJ001]
          Length = 207

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/178 (36%), Positives = 105/178 (58%), Gaps = 4/178 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           +QR  QRV+  L GR++L D  EY C   ++SPGG+ + C V +  +GER ++++E++GR
Sbjct: 19  EQRRHQRVRATLLGRYMLADRREYPCQTVDMSPGGVRLTCAV-IGALGERVVLYLEQIGR 77

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG +V      G+A+RI  +  +R K+A +L+WLAN++ L L + R   R +     V 
Sbjct: 78  LEGVIVRHPPG-GFAMRINATPRKRDKIASQLMWLANRESLGLPEGRTNERLVPNQPGVT 136

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
             L L +    + ++IDIS SGV+++      + + +L     GRVVR F GGI  +F
Sbjct: 137 --LRLENGRFIAARIIDISMSGVALATASAPPIGTHLLVGSTPGRVVRYFEGGIGAQF 192


>gi|240138848|ref|YP_002963323.1| hypothetical protein MexAM1_META1p2255 [Methylobacterium extorquens
           AM1]
 gi|254561451|ref|YP_003068546.1| hypothetical protein METDI3037 [Methylobacterium extorquens DM4]
 gi|240008820|gb|ACS40046.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
 gi|254268729|emb|CAX24690.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 199

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/178 (36%), Positives = 104/178 (58%), Gaps = 4/178 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           +QR  QRV+  L GR++L D  EY C   ++SPGG+ + C V +  + ER ++++E++GR
Sbjct: 11  EQRRHQRVRATLLGRYMLADRREYPCQTVDMSPGGVRLTCAV-IGALNERVVLYLEQIGR 69

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG +V     RG+A+RI  +  +R K+A +L+WLAN++ L L + R   R +     V 
Sbjct: 70  LEGVIVRHPP-RGFAMRINATPRKRDKIASQLMWLANRESLGLPEGRTNERLVPNQPGVT 128

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
             L L      + ++IDIS SGV+++      + + +L     GRVVR F GGI  +F
Sbjct: 129 --LRLESGRFIAARIIDISMSGVALATASSPPIGAHILVGSTPGRVVRYFEGGIGAQF 184


>gi|163851681|ref|YP_001639724.1| type IV pilus assembly PilZ [Methylobacterium extorquens PA1]
 gi|163663286|gb|ABY30653.1| type IV pilus assembly PilZ [Methylobacterium extorquens PA1]
          Length = 207

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/178 (36%), Positives = 104/178 (58%), Gaps = 4/178 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           +QR  QRV+  L GR++L D  EY C   ++SPGG+ + C V +  + ER ++++E++GR
Sbjct: 19  EQRRHQRVRATLLGRYMLADRREYPCQTVDMSPGGVRLTCAV-IGALNERVVLYLEQIGR 77

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG +V     RG+A+RI  +  +R K+A +L+WLAN++ L L + R   R +     V 
Sbjct: 78  LEGVIVRHPP-RGFAMRINATPRKRDKIASQLMWLANRESLGLPEGRTNERLVPNQPGVT 136

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
             L L      + ++IDIS SGV+++      + + +L     GRVVR F GGI  +F
Sbjct: 137 --LRLESGRFIAARIIDISMSGVALATASSPPIGAHILVGSTPGRVVRYFEGGIGAQF 192


>gi|328543254|ref|YP_004303363.1| Type IV pilus assembly PilZ [polymorphum gilvum SL003B-26A1]
 gi|326413000|gb|ADZ70063.1| Type IV pilus assembly PilZ [Polymorphum gilvum SL003B-26A1]
          Length = 212

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/187 (32%), Positives = 116/187 (62%), Gaps = 4/187 (2%)

Query: 11  IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
           ID+R  QRV +++ GRF+L +  EY C V  +SPGG+ ++  V    VGER + +++ +G
Sbjct: 18  IDRRRHQRVAINVLGRFMLENRQEYPCQVINMSPGGVAMITPV-SGRVGERVVAYLDHIG 76

Query: 71  RIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREV 130
           R+EG +   +   G+A+ +  ++ +R KLA+ L WLAN+++L+L + R + R + ++   
Sbjct: 77  RVEGTIAR-EIEGGFAIALHNTQRKRDKLANILTWLANRNELNLPEDRRHDRFVPKNPMT 135

Query: 131 DAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFS 190
             ++VL D T   C+++D+S SG +++   +  + ++V    +  R+VR    GIA+EF+
Sbjct: 136 --RMVLPDGTSFMCRLLDVSLSGAALACTARPPLGTEVALGKMRARIVRHTEDGIAVEFA 193

Query: 191 SVQESNI 197
           ++Q  ++
Sbjct: 194 AIQNRDL 200


>gi|239832143|ref|ZP_04680472.1| type IV pilus assembly PilZ [Ochrobactrum intermedium LMG 3301]
 gi|239824410|gb|EEQ95978.1| type IV pilus assembly PilZ [Ochrobactrum intermedium LMG 3301]
          Length = 202

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 63/186 (33%), Positives = 111/186 (59%), Gaps = 6/186 (3%)

Query: 11  IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
           + Q  F  V VDL GR++L + +E+ C+++ +SPG   ++  +     GER I +++ VG
Sbjct: 14  VRQENFNAVNVDLNGRYMLENRSEFPCVIKRMSPG-TALMSGIATPRNGERIIAYIDHVG 72

Query: 71  RIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKIT-RDRE 129
           RIEG + +  ++ G+ + + TSE ++ KL+ +L WLANK +L L + R + R +  ++R+
Sbjct: 73  RIEG-IAHEVTSEGFHILLATSEQKKDKLSAQLTWLANKHELALPEDRRHERVVPHKNRQ 131

Query: 130 VDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
               +   D T+  C++ D+S SG ++  + +  + S V+   I G VVR F  G AIEF
Sbjct: 132 ---NITFADGTQRLCRIADLSLSGAAIESEFKPAIKSSVMLGPIRGTVVRHFQDGFAIEF 188

Query: 190 SSVQES 195
           +++Q S
Sbjct: 189 ATIQTS 194


>gi|218530487|ref|YP_002421303.1| type IV pilus assembly PilZ [Methylobacterium chloromethanicum CM4]
 gi|218522790|gb|ACK83375.1| type IV pilus assembly PilZ [Methylobacterium chloromethanicum CM4]
          Length = 207

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 64/178 (35%), Positives = 104/178 (58%), Gaps = 4/178 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           +QR  QRV+  L GR++L D  EY C   ++SPGG+ + C V +  + ER ++++E++GR
Sbjct: 19  EQRRHQRVRATLLGRYMLADRREYPCQTVDMSPGGVRLTCAV-IGALNERVVLYLEQIGR 77

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG +V     RG+A+RI  +  +R K+A +L+WLAN++ L L + R   R +     V 
Sbjct: 78  LEGVIVRHPP-RGFAMRINATPRKRDKIASQLMWLANRESLGLPEGRTNERLVPNQPGVT 136

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
             L L      + ++IDIS SGV+++      + + ++     GRVVR F GGI  +F
Sbjct: 137 --LRLESGRFIAARIIDISMSGVALATASSPPIGAHIMVGSTPGRVVRYFEGGIGAQF 192


>gi|39936483|ref|NP_948759.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris CGA009]
 gi|39650339|emb|CAE28861.1| conserved unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 183

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 107/175 (61%), Gaps = 4/175 (2%)

Query: 19  VKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVN 78
           +KV L GR++L D  E+ C V  +SPGGL ++    +  VG+R I +++ VGR+EGK+  
Sbjct: 1   MKVHLLGRYMLPDRREFPCQVINMSPGGLALLAPG-IGNVGDRVIAYLDHVGRVEGKITR 59

Query: 79  FDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLND 138
              N G+A+ +  +  +R KLA +L WLAN+D L+L + R + R + R+    A L L+D
Sbjct: 60  IIDN-GFAMTVAATPRKRDKLAAQLTWLANRDILNLPEDRRHDRIVPRN--PIAVLTLDD 116

Query: 139 NTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQ 193
            ++ SC++ID+S SG +++ + +  + ++VL   +  RVVR    G A+EF   Q
Sbjct: 117 GSRMSCRIIDMSRSGAAIAAEQRPPLNAQVLLGRVASRVVRHLDDGFALEFVHEQ 171


>gi|170751021|ref|YP_001757281.1| type IV pilus assembly PilZ [Methylobacterium radiotolerans JCM
           2831]
 gi|170657543|gb|ACB26598.1| type IV pilus assembly PilZ [Methylobacterium radiotolerans JCM
           2831]
          Length = 213

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 106/178 (59%), Gaps = 4/178 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           DQR  QRV+V + GR++L D  EY C   ++SPGG+ + C V    VGER ++++E +GR
Sbjct: 25  DQRRHQRVRVAVLGRYMLADRREYPCQTVDMSPGGVRLTCAV-KGEVGERVVLYLEHIGR 83

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           IEG VV      G+AV++  +  +R KLA +L WLAN++ L L + R++ R +  +  V 
Sbjct: 84  IEG-VVARTCPDGFAVQLNATSRKRDKLASQLTWLANREMLGLPEGRSHERLVPTNTAV- 141

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
             L +    +   ++IDIS SGV++S  + + + + V      GR+VR F GG  ++F
Sbjct: 142 -VLRVEGGREIRARLIDISMSGVAISCPVPLPLGAAVTVGSTPGRLVRYFEGGFGVQF 198


>gi|227821814|ref|YP_002825784.1| hypothetical protein NGR_c12500 [Sinorhizobium fredii NGR234]
 gi|227340813|gb|ACP25031.1| hypothetical protein NGR_c12500 [Sinorhizobium fredii NGR234]
          Length = 203

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 65/182 (35%), Positives = 108/182 (59%), Gaps = 5/182 (2%)

Query: 13  QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRI 72
           + AFQRV V+L GR +L +  EY C   ++SPG + +         GER I +++ VGR+
Sbjct: 17  ENAFQRVSVNLSGRLMLANRDEYECTAVDMSPGDV-LFSTAARPRAGERIIAYIDHVGRL 75

Query: 73  EGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDA 132
           EG V     +  + +++  ++ +R KLA +L W+ANK +L L + R + R     R+   
Sbjct: 76  EGTVSRLAED-AFVIQLNATDRKREKLAAQLTWIANKHELGLPEDRRHDRLAP--RKTVT 132

Query: 133 QLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKV-LFNDILGRVVRIFPGGIAIEFSS 191
           +L ++   K+ C++ID+S SG +V +D++  + + V L N + GR+VR F  G+AIEFS 
Sbjct: 133 ELTVDTGEKYICRIIDLSLSGAAVDIDVRPAIGTAVRLGNGMKGRIVRHFQEGVAIEFSG 192

Query: 192 VQ 193
           +Q
Sbjct: 193 IQ 194


>gi|218681768|ref|ZP_03529535.1| type IV pilus assembly PilZ [Rhizobium etli CIAT 894]
          Length = 163

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 98/157 (62%), Gaps = 4/157 (2%)

Query: 37  CIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENER 96
           C+V ++SPG + + C        ER + +++ +GR+EG V   D  RG+A+ I  +E +R
Sbjct: 2   CMVIDMSPGDMYVTCS-GRPRANERVVAYIDHLGRVEGYVQTLD-GRGFAMSINATERKR 59

Query: 97  RKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSV 156
            KLA +L WLANK +L L + R + R   RD   + +L L D T++SC+++D+S SG +V
Sbjct: 60  EKLAAQLTWLANKHELGLPEDRRHDRLTPRD--TNTELTLEDGTRYSCRIMDLSLSGAAV 117

Query: 157 SVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQ 193
            V+++  + + V   ++ GRVVR F  G+AIEF S+Q
Sbjct: 118 DVEMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLSIQ 154


>gi|86357823|ref|YP_469715.1| hypothetical protein RHE_CH02207 [Rhizobium etli CFN 42]
 gi|86281925|gb|ABC90988.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 161

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 96/156 (61%), Gaps = 4/156 (2%)

Query: 38  IVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERR 97
           +V ++SPG + + C        ER + +++ +GR+EG V   DS RG+ + I  +E +R 
Sbjct: 1   MVIDMSPGDMYVTCS-GRPRANERVVAYIDHLGRVEGYVQTLDS-RGFTMSINATERKRE 58

Query: 98  KLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVS 157
           KLA +L WLANK +L L + R + R   RD     +L L D T+++C+++D+S SG ++ 
Sbjct: 59  KLAAQLTWLANKHELGLPEDRRHDRLTPRD--TKTELTLEDGTRYTCRIMDLSLSGAAID 116

Query: 158 VDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQ 193
           V+++  + + V   ++ GRVVR F  G+AIEF S+Q
Sbjct: 117 VEMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLSIQ 152


>gi|90417800|ref|ZP_01225712.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337472|gb|EAS51123.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 216

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 106/181 (58%), Gaps = 6/181 (3%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++ +F RV++DL GRF+  D TE+ C    +SPG + +   V + +  ER IV+++ +GR
Sbjct: 31  ERSSFMRVRIDLLGRFMREDRTEFPCRAENMSPGDVSVTASV-VPVENERIIVYIDHIGR 89

Query: 72  IEGKVVN-FDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREV 130
           +EG V   F+   G+ +   ++  +R KLA +L W AN+ +L L + R + R    +  V
Sbjct: 90  LEGAVSRVFEG--GFDLAFQSTPRKREKLAAQLTWFANRHELSLPEDRRHERNAPENPFV 147

Query: 131 DAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFS 190
           D  +VL+D  ++  ++ID+S SG +V+  ++  + S++      GR+VR    G A+EFS
Sbjct: 148 D--MVLDDGRRYPAQIIDLSLSGAAVTSSIRPAVGSRITLGTTTGRIVRHIEDGFAVEFS 205

Query: 191 S 191
           +
Sbjct: 206 A 206


>gi|154253084|ref|YP_001413908.1| type IV pilus assembly PilZ [Parvibaculum lavamentivorans DS-1]
 gi|154157034|gb|ABS64251.1| type IV pilus assembly PilZ [Parvibaculum lavamentivorans DS-1]
          Length = 205

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/191 (32%), Positives = 108/191 (56%), Gaps = 6/191 (3%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R + RV V+  GRFL  DG+E+ C +R+IS GG+ I   VP+  +G + IV+++  GR
Sbjct: 13  ERRRYPRVAVETPGRFLAPDGSEHQCALRDISIGGIAISSPVPL-QIGAQIIVYIDDFGR 71

Query: 72  IEGKVVN-FDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDR-- 128
            EGK+V  FD   G+A+    S   R +L  +L  LA  + + +   RA+ R +  +   
Sbjct: 72  FEGKIVRVFDG--GFAIETAISGPRRERLQQRLEALARGEKIDVSARRAFARYVPGEAGL 129

Query: 129 EVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIE 188
           E  + L + D +   C++ID+S  G  V++D +  + ++V    + GR+VR    G+ I+
Sbjct: 130 EESSVLTMTDGSSIPCRIIDMSLGGAQVAIDPRPMIGTQVSIGKMQGRIVRHTEEGVGIQ 189

Query: 189 FSSVQESNIAF 199
           F++V E + A 
Sbjct: 190 FTNVPEHSNAL 200


>gi|327188331|gb|EGE55549.1| hypothetical protein RHECNPAF_910024 [Rhizobium etli CNPAF512]
          Length = 161

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/156 (36%), Positives = 97/156 (62%), Gaps = 4/156 (2%)

Query: 38  IVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERR 97
           +V ++SPG + + C        ER + +++ +GR+EG V   D  RG+ + I  +E +R 
Sbjct: 1   MVIDMSPGDMYVTCP-GRPRANERVVAYIDHLGRVEGYVQTLD-GRGFTMSINATERKRE 58

Query: 98  KLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVS 157
           KLA +L WLANK +L L + R + R   RD  +  +L L+D T+++C+++D+S SG ++ 
Sbjct: 59  KLAAQLTWLANKHELGLPEDRRHDRLTPRD--IKTELTLDDGTRYACRIMDLSLSGAAID 116

Query: 158 VDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQ 193
           V+++  + + V   ++ GRVVR F  G+AIEF S+Q
Sbjct: 117 VEMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLSIQ 152


>gi|114704737|ref|ZP_01437645.1| hypothetical protein FP2506_07371 [Fulvimarina pelagi HTCC2506]
 gi|114539522|gb|EAU42642.1| hypothetical protein FP2506_07371 [Fulvimarina pelagi HTCC2506]
          Length = 195

 Score =  107 bits (267), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 101/177 (57%), Gaps = 4/177 (2%)

Query: 16  FQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGK 75
           +  V VD+ GRF+  D +EY C + E+SPG + ++  V    + ER IV+ + VGR+EG+
Sbjct: 12  YSAVSVDILGRFMRSDTSEYPCRIEEMSPGAVQVIAPVAPD-IRERIIVYADHVGRLEGE 70

Query: 76  VVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLV 135
           V       G+ ++ + SE  R KLA KL WL N+  L+L + R + R    +   D  +V
Sbjct: 71  VAELFEG-GFCLKTLASERRREKLAAKLTWLTNRQLLNLPEDRRHERVQPENPFRD--IV 127

Query: 136 LNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSV 192
           L+D  ++  K+ID+S SG ++   ++  + + +    + GR++R    G A+EFSSV
Sbjct: 128 LDDGRRYKVKIIDLSLSGAALQSKVRPVIGTSITLGAMPGRIIRYLEDGFAVEFSSV 184


>gi|15889059|ref|NP_354740.1| hypothetical protein Atu8163 [Agrobacterium tumefaciens str. C58]
 gi|15156856|gb|AAK87525.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 205

 Score =  102 bits (254), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 99/179 (55%), Gaps = 5/179 (2%)

Query: 19  VKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVN 78
           V+V   GR +L D  EY+C   E++       C   M   G+R I +++ +GRIEG V  
Sbjct: 25  VRVSFTGRLMLPDHEEYDCTATEMTAERAQFTCSG-MARNGDRVIAYLQHIGRIEGTVTA 83

Query: 79  FDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLND 138
             +  G+ + I   E +R KLA +L W+A +  L L + R + R   R+    AQLVL D
Sbjct: 84  L-TPAGFLIAINAPERKREKLAAQLAWIAKRQLLGLPEDRRHDRLTPRN--AKAQLVLED 140

Query: 139 NTKHSCKVIDISESGVSVSVDLQIEMFSKV-LFNDILGRVVRIFPGGIAIEFSSVQESN 196
               +C++ID+S SG ++ ++ +  + S+V L  ++ G++VR F  G+A+EF  VQ  +
Sbjct: 141 GVLVACRLIDLSLSGAAIEIENRPPLGSRVQLGKNMSGKIVRHFMEGVAVEFDRVQSPD 199


>gi|163760300|ref|ZP_02167383.1| hypothetical protein HPDFL43_08559 [Hoeflea phototrophica DFL-43]
 gi|162282699|gb|EDQ32987.1| hypothetical protein HPDFL43_08559 [Hoeflea phototrophica DFL-43]
          Length = 171

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 97/166 (58%), Gaps = 4/166 (2%)

Query: 31  DGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIV 90
           D +E++C+V  +SP    I  +     VGER + +++ +GRIEG V      R + + + 
Sbjct: 4   DHSEHDCVVDTMSPFDAVISSNA-QPAVGERIVAYLDYLGRIEGAVTEA-GMRTFTMSLN 61

Query: 91  TSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDIS 150
            ++ +R KL+ +L WLANK +L L + R + R    +   + QL   D  ++ C++ID+S
Sbjct: 62  ATDRKRDKLSAQLTWLANKHELGLPEDRNHERVAPSNPSSEIQL--EDGRRYPCRIIDLS 119

Query: 151 ESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESN 196
            SG ++ +D++    + V+  ++ GRVVR F  GIA+EF++VQ  +
Sbjct: 120 VSGAAIEIDVRPAFGTMVILGNMRGRVVRHFQEGIAMEFTTVQPED 165


>gi|325293138|ref|YP_004279002.1| hypothetical protein AGROH133_06723 [Agrobacterium sp. H13-3]
 gi|325060991|gb|ADY64682.1| hypothetical protein AGROH133_06723 [Agrobacterium sp. H13-3]
          Length = 205

 Score = 97.8 bits (242), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 104/195 (53%), Gaps = 10/195 (5%)

Query: 3   RGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERS 62
           R +  + F D      V+V   GR +L D  EY+C   E++       C   +   G+R 
Sbjct: 14  RPVEEVHFDDP-----VRVSFTGRLMLPDHQEYDCTATEMTAERALFACSG-IARNGDRV 67

Query: 63  IVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGR 122
           I +++ +GRIEG V    ++ G+ + I   E +R KLA +L W+A +  L L + R + R
Sbjct: 68  ISYLQHIGRIEGTVTALTAS-GFVIAINAPERKREKLAAQLAWIAKRQLLGLPEDRRHDR 126

Query: 123 KITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKV-LFNDILGRVVRIF 181
              R+    A L+L D    +C++ID+S SG ++ ++ +  + ++V L  ++ G++VR F
Sbjct: 127 LTPRN--TRAHLMLEDGVLLACRLIDLSLSGAAIEIENRPPLGTRVQLGKNMSGKIVRHF 184

Query: 182 PGGIAIEFSSVQESN 196
             G+A+EF  VQ  +
Sbjct: 185 MEGVAVEFDRVQSPD 199


>gi|323136579|ref|ZP_08071660.1| type IV pilus assembly PilZ [Methylocystis sp. ATCC 49242]
 gi|322397896|gb|EFY00417.1| type IV pilus assembly PilZ [Methylocystis sp. ATCC 49242]
          Length = 201

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 100/177 (56%), Gaps = 4/177 (2%)

Query: 13  QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRI 72
           +R    V+VDL+GRF+L  G E+ C +  +S G +     V   L GE+ IV++ ++GR 
Sbjct: 14  ERIHNSVEVDLEGRFMLASGAEHPCRIVAMSTGEMLFSTPVRPRL-GEKVIVYIAELGRF 72

Query: 73  EGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDA 132
           EG V   +   G+A+ +  +E + RKLA++L+W AN+D L L + R + R +   +    
Sbjct: 73  EGGVSRHEGE-GFAIGLKLTEMKHRKLAEQLVWFANRDVLDLPENRRHKRIVPMLQWTIV 131

Query: 133 QLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
           +  L++  + + K+ DIS SGVSV V+ +  +  +V+      +VVR+  GG   EF
Sbjct: 132 R--LSNGKEKTAKINDISLSGVSVEVNARPLVGGRVMVGSKAAKVVRLVDGGFVAEF 186


>gi|323138251|ref|ZP_08073323.1| type IV pilus assembly PilZ [Methylocystis sp. ATCC 49242]
 gi|322396503|gb|EFX99032.1| type IV pilus assembly PilZ [Methylocystis sp. ATCC 49242]
          Length = 204

 Score = 94.4 bits (233), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 94/178 (52%), Gaps = 4/178 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           + R FQRV V + GR++L    EY C   E+SPG + +   V    VGE+ +V+++++GR
Sbjct: 16  ENRRFQRVPVKMFGRYMLESRREYPCQTVEMSPGDMTLFAPV-KAEVGEKVVVYLDEIGR 74

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
             G  V   ++ G+A+ +     +R KLAD+L W AN+   +L + R + R +   +   
Sbjct: 75  FAGVAVRV-TDTGFAMAMNLPPMKRDKLADQLTWFANRHAFNLPEDRRHERIVPLMQRT- 132

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
             L + D  +   K+ DIS SGV V  D +  + +++L       VVR F  GI  EF
Sbjct: 133 -LLRMPDGQELMAKIRDISLSGVGVETDARPPLGARILVGSTPALVVRHFDSGIGGEF 189


>gi|300023305|ref|YP_003755916.1| type IV pilus assembly PilZ [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525126|gb|ADJ23595.1| type IV pilus assembly PilZ [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 208

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 93/186 (50%), Gaps = 7/186 (3%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCD-VPMFLVGERSIVFVEKVG 70
           D R  +R+ + L GRF+  D  E+NC +  IS GG  +V    P   VGER I + + +G
Sbjct: 22  DMRRHRRLPLSLAGRFMRADRNEFNCQLENISVGGAAVVSPHAPE--VGERVIAYFDHLG 79

Query: 71  RIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREV 130
            +EG V     + G+A     +E++R KLA +++WL N+ D   +  R + R  TR R  
Sbjct: 80  GVEGVVARHTPD-GFAFSFKVTEHKREKLAAQIMWLINRSDFPEEAGRLHERVGTRGRRT 138

Query: 131 DAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFS 190
             ++   ++     +++D+S SG S+    +  + S V+       V R    GI ++F 
Sbjct: 139 TLRV---EDVIIDVELLDLSASGASLGTPARPPLGSFVVAGKTRAIVRRHHAQGIGVQFL 195

Query: 191 SVQESN 196
           ++Q   
Sbjct: 196 TLQSPE 201


>gi|316935320|ref|YP_004110302.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris DX-1]
 gi|315603034|gb|ADU45569.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris DX-1]
          Length = 243

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 103/197 (52%), Gaps = 17/197 (8%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTEYN-------CIVREISPGGLCIVCDVPMF-LVGE 60
           +F+ QRA   V V + G + L +  + N       C    +SP    ++ DVP+   VG+
Sbjct: 5   RFLKQRA---VNVTVGGNYSLANWYDQNGKLRQFACRTSRVSP--FRMIVDVPVIGRVGD 59

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKD-DLHLQDCRA 119
           +   +  + G++EG + +     G+ + +  +   R +L+++L WL  K  D  ++D R 
Sbjct: 60  QISSYFSEFGKLEGHISDTLPG-GFLLELAVTRAMRERLSNQLSWLERKMLDPEIKDARE 118

Query: 120 YGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVR 179
             R +       + L+L D + H+C VID+S SGV+VS D+Q E+ + +     +GRVVR
Sbjct: 119 QARIVPACPH--STLILADGSTHTCFVIDMSISGVAVSADVQPEIGTPLAVGGCVGRVVR 176

Query: 180 IFPGGIAIEFSSVQESN 196
             P G A++F+ +Q  N
Sbjct: 177 HRPDGFAVKFTELQNRN 193


>gi|114569626|ref|YP_756306.1| type IV pilus assembly PilZ [Maricaulis maris MCS10]
 gi|114340088|gb|ABI65368.1| type IV pilus assembly PilZ [Maricaulis maris MCS10]
          Length = 207

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 94/191 (49%), Gaps = 7/191 (3%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVF-VEKVG 70
           ++R   RV + L GRF      E+ C + +ISPGG  I+    + L  E  IV  +  +G
Sbjct: 22  ERRRHARVPLQLHGRFWSEANGEHACRLVDISPGGARIIAR--LNLAAETRIVLMITSIG 79

Query: 71  RIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREV 130
           RIEG+VV   S    ++R      +R KLAD + W  NKD L L++ R   RK  R R  
Sbjct: 80  RIEGQVVR-QSGEEISIRFNAPLRKRDKLADAITWRFNKDRLGLEEDRTAPRKPGRGR-- 136

Query: 131 DAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFS 190
            A+++L+D       V+D+S +G +     +  +   +   ++ GRV RI   G A+ F 
Sbjct: 137 -ARILLSDGVVIQANVVDVSVTGAAFECLERPRVGEGLRVGEMSGRVARILDNGFAVVFD 195

Query: 191 SVQESNIAFKS 201
             + +    ++
Sbjct: 196 PPEATAAGHEA 206


>gi|114799843|ref|YP_761349.1| hypothetical protein HNE_2667 [Hyphomonas neptunium ATCC 15444]
 gi|114740017|gb|ABI78142.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 203

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 92/185 (49%), Gaps = 18/185 (9%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERS------IVF 65
           D+R F+R+++ L GRFL+ D  ++     +IS       CD    +  ER       + +
Sbjct: 20  DRRGFKRIELKLAGRFLIGDSEDHVLSTADIS-------CDGAFIVSSERPGLDQQVVCY 72

Query: 66  VEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKIT 125
            ++VGR+   VV   S  G+AVR  TS ++R KLAD+L WL N+D L L++ R   R   
Sbjct: 73  FDEVGRVVANVVRV-SPEGFAVRFHTSPHKRDKLADRLTWLLNRDKLGLEEERGEARYQA 131

Query: 126 RDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFS-KVLFNDILGRVVRIFPGG 184
                +A + L++     C V DIS +G +     +      +V   +++G VVR+    
Sbjct: 132 SG---EATVNLSNGGHIQCSVTDISLTGAAFETGGKAPFVGERVTVGNLVGEVVRVAGNK 188

Query: 185 IAIEF 189
            A+ +
Sbjct: 189 FAVRY 193


>gi|83945654|ref|ZP_00958000.1| hypothetical protein OA2633_15190 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851020|gb|EAP88879.1| hypothetical protein OA2633_15190 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 204

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 82/167 (49%), Gaps = 5/167 (2%)

Query: 23  LKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSN 82
           + GR L     E+ C + +ISPGG  I C  P     ER ++  + +GR+EG+V+    +
Sbjct: 36  VPGRGLSPSAGEFTCTLVDISPGGARIACKTPPEKA-ERVVLLFDGLGRLEGEVLRAGRS 94

Query: 83  RGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKH 142
            G+ VR+  S+ +R +LAD + W  N   L L + R   RK  R R   A++ L D    
Sbjct: 95  -GFIVRLHGSQRKRDRLADAITWRFNMQRLGLDEDRTAPRKPGRGR---AKIRLRDGVVI 150

Query: 143 SCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
              VID+S SG + +   +  +   V   D+ G V R    G A+ F
Sbjct: 151 QADVIDVSISGAAFACLERPRIGEAVRVGDMQGHVARWLDNGFAVAF 197


>gi|90423310|ref|YP_531680.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisB18]
 gi|90105324|gb|ABD87361.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisB18]
          Length = 235

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 96/190 (50%), Gaps = 17/190 (8%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTE-------YNCIVREISPGGLCIVCDVPMF-LVGE 60
           +F+ QRA   V + + G + L +  +       + C    +SP    ++  VP+   +G+
Sbjct: 5   KFLKQRA---VNLVVGGHYTLANWYDMQGKPRNFACRTSRVSP--FRMIMAVPVVGRIGD 59

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWL-ANKDDLHLQDCRA 119
               +  + GR+EG++ +     G+ + +      RRKLAD+L WL A + D  ++D R 
Sbjct: 60  HITSYFSEFGRLEGRISDTMPG-GFLLELAMPHALRRKLADQLAWLEARQRDPSVRDARR 118

Query: 120 YGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVR 179
             R I       + L   D + H C VID+S SGV++S D+Q E+ + +     +GRVVR
Sbjct: 119 QARIIPATPH--STLTFADGSIHGCFVIDMSVSGVAISADVQPEVGTPLAVGACVGRVVR 176

Query: 180 IFPGGIAIEF 189
              GG A++F
Sbjct: 177 HLNGGFAVKF 186


>gi|146342076|ref|YP_001207124.1| hypothetical protein BRADO5217 [Bradyrhizobium sp. ORS278]
 gi|146194882|emb|CAL78907.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 231

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 96/190 (50%), Gaps = 17/190 (8%)

Query: 9   QFIDQRAFQRVKVDLKGRFLL---FDGT----EYNCIVREISPGGLCIVCDVPMF-LVGE 60
           +F+ QRA   V++   G + L   +D       + C    +SP     + DVP+   VG+
Sbjct: 6   RFLKQRA---VRIQTAGTYTLPNWYDPEGKLRSFACRTTRVSP--FRALLDVPVVGKVGD 60

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKD-DLHLQDCRA 119
           R   +    G+ EG++ +   + G+ + +  +  ER KLA+KL+WL  K  D  ++D R 
Sbjct: 61  RLTSYFRDFGKFEGEISD-TVHGGFLLELEMTRAERAKLAEKLVWLEKKQKDPTVRDSRR 119

Query: 120 YGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVR 179
             R +       + L L D +   C VID S SG +VS ++Q E+ + +     +GRVVR
Sbjct: 120 EARFVPNSPH--SALTLADGSIIPCFVIDASMSGAAVSAEVQPEIGTPLAVGSCVGRVVR 177

Query: 180 IFPGGIAIEF 189
            FP G A++F
Sbjct: 178 HFPDGFAVKF 187


>gi|254293022|ref|YP_003059045.1| type IV pilus assembly PilZ [Hirschia baltica ATCC 49814]
 gi|254041553|gb|ACT58348.1| type IV pilus assembly PilZ [Hirschia baltica ATCC 49814]
          Length = 193

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 94/188 (50%), Gaps = 10/188 (5%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           + N+   D+R F+RV  +   R L  DG E+N    ++  GG+ +  D P  L G++ I+
Sbjct: 11  VRNIGAKDRRRFRRVIHETTARCLWKDGHEFNAKTVDLCGGGVSLRTDEPCNL-GDQIII 69

Query: 65  FVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKI 124
           +V+++GR+ G      +  G+AV +     +  K  D+L W+ N+  L L+D R     +
Sbjct: 70  YVDQLGRLAGTAAR-KTEEGFAVSVKFVPQKLDKFVDQLTWIVNQRSLGLEDDR-----L 123

Query: 125 TRDREVDAQLVLNDNTK--HSCKVIDISESGVSV-SVDLQIEMFSKVLFNDILGRVVRIF 181
           +R R    QL+    +     C VIDIS  GV++ +   + E+ S+V      GR  R  
Sbjct: 124 SRRRTSSGQLIATYESGIVAQCNVIDISLLGVALRTSGPRPEIGSRVQIGRKAGRCARYV 183

Query: 182 PGGIAIEF 189
             G A+EF
Sbjct: 184 ENGFAVEF 191


>gi|192290093|ref|YP_001990698.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris TIE-1]
 gi|192283842|gb|ACF00223.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris TIE-1]
          Length = 243

 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 99/194 (51%), Gaps = 17/194 (8%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTEYN-------CIVREISPGGLCIVCDVPMF-LVGE 60
           +F+ QRA   V V + G + L +  + N       C    +SP    ++ DVP+   VG+
Sbjct: 5   RFLKQRA---VNVTVGGNYSLANWYDQNGKLRQFACRTSRVSP--FRMIVDVPVIGRVGD 59

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKD-DLHLQDCRA 119
               +  + G+++G + +     G+ + +  +   R +L+++L WL  K  D  ++D R 
Sbjct: 60  HISSYFSEFGKLDGHISDTLPG-GFLLELAVTRAMRERLSNQLSWLEKKMLDPAIKDARE 118

Query: 120 YGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVR 179
             R +       + L L D + H+C VID+S SG +VS DLQ E+ + +     +GRVVR
Sbjct: 119 QARVVPVCPH--SSLTLADGSSHTCFVIDMSISGAAVSADLQPEIGTPLAVGSCVGRVVR 176

Query: 180 IFPGGIAIEFSSVQ 193
             P G A++F+ +Q
Sbjct: 177 HRPDGFAVKFTELQ 190


>gi|39934580|ref|NP_946856.1| hypothetical protein RPA1508 [Rhodopseudomonas palustris CGA009]
 gi|39648429|emb|CAE26950.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 243

 Score = 78.2 bits (191), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 98/194 (50%), Gaps = 17/194 (8%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTEYN-------CIVREISPGGLCIVCDVPMF-LVGE 60
           +F+ QRA   V V + G + L +    N       C    +SP    ++ DVP+   VG+
Sbjct: 5   RFLKQRA---VNVTVGGNYSLANWYNQNGKLRQFACRTSRVSP--FRMIVDVPVIGRVGD 59

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKD-DLHLQDCRA 119
               +  + G+++G + +     G+ + +  +   R +L+++L WL  K  D  ++D R 
Sbjct: 60  HISSYFSEFGKLDGHISDTLPG-GFLLELAVTRAMRERLSNQLSWLEKKMLDPAIKDARE 118

Query: 120 YGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVR 179
             R +       + L L D + H+C VID+S SG +VS DLQ E+ + +     +GRVVR
Sbjct: 119 QARVVPVCPH--SSLTLADGSSHTCFVIDMSISGAAVSADLQPEIGTPLAVGSCVGRVVR 176

Query: 180 IFPGGIAIEFSSVQ 193
             P G A++F+ +Q
Sbjct: 177 HRPDGFAVKFTELQ 190


>gi|304391876|ref|ZP_07373818.1| type IV pilus assembly PilZ [Ahrensia sp. R2A130]
 gi|303296105|gb|EFL90463.1| type IV pilus assembly PilZ [Ahrensia sp. R2A130]
          Length = 209

 Score = 77.8 bits (190), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 97/180 (53%), Gaps = 8/180 (4%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           D RA +R +++L GR LL +G E  C   +I    + I   +    +G+  IV+++++GR
Sbjct: 23  DDRAVERFRLELSGRCLLPNGLELPCQTTDIQHNAVSITA-LDSAELGQTIIVYLDELGR 81

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKD--DLHLQDCRAYGRKITRDRE 129
           + G+V       G+ + +  +E +R KLA+ +   A++D  D  L D    G       E
Sbjct: 82  LSGEVTRIFEG-GFVLALELTERKRDKLAEHIESYADRDLIDQVLSD----GPSTPNINE 136

Query: 130 VDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
            + +LVL D   +  ++ D+S SG S++ ++   + ++V    + GRVV+ +PGG+ +EF
Sbjct: 137 RNERLVLTDGRSYPVQIKDLSLSGASMTCEVIPALSAQVEVAGLSGRVVQHYPGGLRVEF 196


>gi|148256955|ref|YP_001241540.1| hypothetical protein BBta_5681 [Bradyrhizobium sp. BTAi1]
 gi|146409128|gb|ABQ37634.1| hypothetical protein BBta_5681 [Bradyrhizobium sp. BTAi1]
          Length = 229

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 97/190 (51%), Gaps = 17/190 (8%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTE-------YNCIVREISPGGLCIVCDVPMF-LVGE 60
           +F+ QRA   V++   G + L +  +       + C    +SP     + DVP+   +G+
Sbjct: 5   RFLKQRA---VRIQTVGSYTLPNWYDPEGKLRSFACRTTRVSP--FRALLDVPVVGKIGD 59

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKD-DLHLQDCRA 119
           R   +  + G+ EG++ +   + G+ + +  +  ER KLA+KL+WL  +  D  ++D R 
Sbjct: 60  RLTSYFREFGKFEGQISD-TVHGGFLLELEMTRAERAKLAEKLVWLEKRQRDPTIRDARR 118

Query: 120 YGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVR 179
             R +       + L+L D +   C VID S SGV+VS +LQ E+ + +     +GRVVR
Sbjct: 119 DARYVPDSPH--SALMLADGSSIPCLVIDASMSGVAVSSELQPEIGTPLAVGSCVGRVVR 176

Query: 180 IFPGGIAIEF 189
            F  G A+ F
Sbjct: 177 HFHDGFAVRF 186


>gi|86751123|ref|YP_487619.1| hypothetical protein RPB_4015 [Rhodopseudomonas palustris HaA2]
 gi|86574151|gb|ABD08708.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 243

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 98/193 (50%), Gaps = 17/193 (8%)

Query: 10  FIDQRAFQRVKVDLKGRFLLFDGTEYN-------CIVREISPGGLCIVCDVPMF-LVGER 61
           F+ QRA   V + + G + L +  + N       C    +SP    ++ DVP+   VG+ 
Sbjct: 6   FLKQRA---VNIAVGGNYSLANWYDQNGKPRNFACRTSRVSP--FRMIVDVPVVGRVGDA 60

Query: 62  SIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANK-DDLHLQDCRAY 120
              +    G+++G + +     G+ + +  +   R +L+++L WL  K +D  + D R  
Sbjct: 61  ISSYFSDFGKLDGHISDTVPG-GFLLELAVTRAMRERLSNQLNWLEKKLNDPAIVDAREQ 119

Query: 121 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI 180
            R +       + L++ D + H+C VID+S SGV+VS D+Q E+ + +     +GRVVR 
Sbjct: 120 ARIVPACPH--SSLIMADGSVHTCFVIDMSISGVAVSADVQPEIGTPLAVGGCVGRVVRH 177

Query: 181 FPGGIAIEFSSVQ 193
              G A++FS +Q
Sbjct: 178 RSDGFAVKFSELQ 190


>gi|115523913|ref|YP_780824.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisA53]
 gi|115517860|gb|ABJ05844.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisA53]
          Length = 240

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 94/194 (48%), Gaps = 17/194 (8%)

Query: 9   QFIDQRAFQRVKVDLKGRFLL---FDG----TEYNCIVREISPGGLCIVCDVPMF-LVGE 60
           +F  QRA   V + + G + L   +D       + C  R ISP    ++ DVP+   +G+
Sbjct: 6   KFFKQRA---VNIVVGGHYTLANWYDAHGKPRSFACRTRRISP--FRMMVDVPVVGRLGD 60

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANK-DDLHLQDCRA 119
               +    G++EG++ +  +   + + +  +   RR++AD+L WL  K  D  ++D R 
Sbjct: 61  SITSYFGDFGQLEGRITDTVAG-SFLLELDMTGEMRRRMADQLSWLEKKLKDPSVRDERK 119

Query: 120 YGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVR 179
           + R +       + L   D    SC VID+S SG ++S D+Q E+ + +     +GRVVR
Sbjct: 120 HARIVPATPH--STLTFGDGATRSCFVIDMSVSGAAISADVQPEIGTPLAVGAAVGRVVR 177

Query: 180 IFPGGIAIEFSSVQ 193
               G A+ F   Q
Sbjct: 178 HRQDGFAVSFVEPQ 191


>gi|323135566|ref|ZP_08070649.1| type IV pilus assembly PilZ [Methylocystis sp. ATCC 49242]
 gi|322398657|gb|EFY01176.1| type IV pilus assembly PilZ [Methylocystis sp. ATCC 49242]
          Length = 173

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 80/162 (49%), Gaps = 4/162 (2%)

Query: 28  LLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAV 87
           +L    EY C   EISPG   +   V   + GE+ ++++  +GR  G +    +  G+ +
Sbjct: 1   MLKSSEEYPCHTFEISPGEASLFAPVKA-MPGEKVVLYLRDLGRFAG-LATRATEIGFEM 58

Query: 88  RIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVI 147
            +  S  +R +LAD+L W AN+  L + + R + R +        +L   D  +H  ++ 
Sbjct: 59  SLQLSPKKRERLADQLTWYANRSALAVDERRRHERIVPLMELTVLRLARGD--EHIVRIR 116

Query: 148 DISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
            +S SGV++  +L   +  +V+  +    VVR F  G+A EF
Sbjct: 117 SLSLSGVALETELTPLLGEQVVIGNTPATVVRFFDDGLACEF 158


>gi|170742548|ref|YP_001771203.1| type IV pilus assembly PilZ [Methylobacterium sp. 4-46]
 gi|168196822|gb|ACA18769.1| type IV pilus assembly PilZ [Methylobacterium sp. 4-46]
          Length = 201

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 85/167 (50%), Gaps = 5/167 (2%)

Query: 23  LKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSN 82
           + GR+LL +G E+ C  R +SP    ++  VP  L G+   ++++ +G I G V+   + 
Sbjct: 25  IAGRYLLPNGDEHACETRSLSPAEADLLAAVPGLL-GDPVTIYLDTIGAITG-VIRSLTP 82

Query: 83  RGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKH 142
            G+ V I  S   R ++A +L WLA + +  + D R+  R +   + V+ +  L D    
Sbjct: 83  TGFVVAIEVSPERRARIAARLDWLAARANGRI-DQRSDARIVPVTKAVEVK--LPDGALL 139

Query: 143 SCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
              +ID+S SG +V++  +  + + V        VVR   GGIA+ F
Sbjct: 140 PGTLIDLSMSGAAVAMAARPAVGATVTVGKRFATVVRHLDGGIAVAF 186


>gi|27379505|ref|NP_771034.1| hypothetical protein bll4394 [Bradyrhizobium japonicum USDA 110]
 gi|27352657|dbj|BAC49659.1| bll4394 [Bradyrhizobium japonicum USDA 110]
          Length = 221

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 94/195 (48%), Gaps = 17/195 (8%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTE-------YNCIVREISPGGLCIVCDVPMF-LVGE 60
           +F+ QRA   V+V + G + L    +       + C  + +SP    ++ DVP+   +GE
Sbjct: 18  EFLRQRA---VEVTVSGSYSLPRWYDCEGKLRTFACRTKRVSP--FRMIVDVPVVGKIGE 72

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKD-DLHLQDCRA 119
           R   + +  G  +   ++     G+ + +  +   R  +++KL WL  K  D  +Q+ R 
Sbjct: 73  RVTSYFQDFGEFQC-TISATLKSGFLMELDMTRARRAWMSEKLTWLEKKQRDASVQELRN 131

Query: 120 YGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVR 179
             R + +       L L D + H C +ID+S +GV++S +    + + +     +GRV+R
Sbjct: 132 DARFVPQVSHTF--LTLADGSTHPCFIIDVSTAGVAISCEYDPPIGTPLAIGACVGRVIR 189

Query: 180 IFPGGIAIEFSSVQE 194
            F  G A++F+  Q+
Sbjct: 190 KFDNGFAVKFAEKQQ 204


>gi|240142085|ref|YP_002966595.1| hypothetical protein MexAM1_META2p0402 [Methylobacterium extorquens
           AM1]
 gi|240012029|gb|ACS43254.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 197

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 85/177 (48%), Gaps = 15/177 (8%)

Query: 18  RVKVDLKGRFLLFDGTEYNCIVREISP--GGLCIVCDVPMFLVGERSIVFVEKVGRIEGK 75
           R ++ + GR LL DGTE +C VR  S     +    D  MF   +R +  +E+VG + G 
Sbjct: 16  RTELLVGGRVLLADGTERSCCVRFDSEDVATVFAAADPAMF---DRVLFRLEEVGSLSGI 72

Query: 76  VVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHL---QDCRAYGRKITRDREVDA 132
           VV  D    + +R+  S   RR++  KL WL    + H    ++ R+  R + R R V  
Sbjct: 73  VVANDRA-SFEIRLEGSGERRRRVQTKLDWL----EAHAGGREERRSEIRIVPRRRTV-- 125

Query: 133 QLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
           Q         + +++D+S SG S+S+ ++  +   VL       VVR    G+A+ F
Sbjct: 126 QFRRPGEEPFTTRILDVSPSGASLSMPIRPGIGETVLVGRRYAEVVRHSDEGVAVRF 182


>gi|218528286|ref|YP_002419102.1| type IV pilus assembly PilZ [Methylobacterium chloromethanicum CM4]
 gi|218520589|gb|ACK81174.1| type IV pilus assembly PilZ [Methylobacterium chloromethanicum CM4]
          Length = 185

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 77/171 (45%), Gaps = 4/171 (2%)

Query: 19  VKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVN 78
           + V L GR LL  G E +C+ R      + +V       VG R I  V+ +G IE  V  
Sbjct: 4   IPVALAGRILLPCGAERDCLCRLSQADEVYVVIGDAGAAVGSRVICHVDGLGVIEASVTT 63

Query: 79  FDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLND 138
             S     + +  S   R +LA +L W   + D   +D R   R I  D  V  ++ L+D
Sbjct: 64  V-SRGSLRLSVEGSPAHRARLATRLAWHRARLDGR-EDQRGAMRVIPLDPSV--EVTLSD 119

Query: 139 NTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
                 +++D+S +G ++ + L+  + + +       RVVR    G+A+ F
Sbjct: 120 GMAVEARIVDLSATGAALEMVLRPPLDAALTLGRRRARVVRHTDTGVAVRF 170


>gi|163852450|ref|YP_001640493.1| type IV pilus assembly PilZ [Methylobacterium extorquens PA1]
 gi|163664055|gb|ABY31422.1| type IV pilus assembly PilZ [Methylobacterium extorquens PA1]
          Length = 196

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 65/125 (52%), Gaps = 3/125 (2%)

Query: 66  VEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKIT 125
           +  +G++E +VV+   N+ + VR++ S     ++A  ++ LA +     +  RA+ R I 
Sbjct: 61  IRYIGQVEARVVSSGDNQ-FVVRLMASRQRAAEVARTMLALAREQGRSFESARAHPR-IN 118

Query: 126 RDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGI 185
             R+ D  + L D      ++I++S SG ++++D  +   + +   D   +VVRIF  GI
Sbjct: 119 PARK-DVLVTLEDGRVLPGRLINVSSSGAALAIDHTLSRGASITIGDTAAKVVRIFRDGI 177

Query: 186 AIEFS 190
              F+
Sbjct: 178 GATFA 182


>gi|218531206|ref|YP_002422022.1| type IV pilus assembly PilZ [Methylobacterium chloromethanicum CM4]
 gi|218523509|gb|ACK84094.1| type IV pilus assembly PilZ [Methylobacterium chloromethanicum CM4]
          Length = 196

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 65/125 (52%), Gaps = 3/125 (2%)

Query: 66  VEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKIT 125
           +  +G++E +VV+   N+ + VR++ S     ++A  ++ LA +     +  RA+ R I 
Sbjct: 61  IRYIGQVEARVVSSGDNQ-FVVRLMASRQRAAEVARTMLALAREQGRTFESARAHPR-IN 118

Query: 126 RDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGI 185
             R+ D  + L D      ++I++S SG ++++D  +   + +   D   +VVRIF  GI
Sbjct: 119 PARK-DVLVTLEDGRVLPGRLINVSSSGAALAIDHTLSRGASITIGDTAAKVVRIFRDGI 177

Query: 186 AIEFS 190
              F+
Sbjct: 178 GAAFA 182


>gi|188582465|ref|YP_001925910.1| type IV pilus assembly PilZ [Methylobacterium populi BJ001]
 gi|179345963|gb|ACB81375.1| type IV pilus assembly PilZ [Methylobacterium populi BJ001]
          Length = 191

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 78/158 (49%), Gaps = 4/158 (2%)

Query: 33  TEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTS 92
            ++  + +++SP G+          V E     +  +G++E +VV+ D N  + VR++TS
Sbjct: 24  ADFYAVTQDLSPDGITFRSAFEP-AVDESLTCSIRYIGQVETRVVSVDDNL-FVVRLMTS 81

Query: 93  ENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISES 152
                ++A  ++ L+ +     +  RA+ R I   R+ D  + L D      ++I++S S
Sbjct: 82  RQRAAEVARTMLALSREQGRSFESARAHPR-INPARK-DVLVTLEDGRVLPGRLINVSAS 139

Query: 153 GVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFS 190
           G ++++D  +   +++       +VVRIF  GI   F+
Sbjct: 140 GAALALDHTLASGARITIGATAAQVVRIFRDGIGAAFA 177


>gi|240139786|ref|YP_002964263.1| hypothetical protein MexAM1_META1p3242 [Methylobacterium extorquens
           AM1]
 gi|240009760|gb|ACS40986.1| hypothetical protein MexAM1_META1p3242 [Methylobacterium extorquens
           AM1]
          Length = 191

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 65/125 (52%), Gaps = 3/125 (2%)

Query: 66  VEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKIT 125
           +  +G++E +VV+   N+ + VR++ S     ++A  ++ LA +     +  RA+ R I 
Sbjct: 56  IRYIGQVEARVVSSGDNQ-FVVRLMASRQRAAEVARTMLALAREQGRTFESARAHPR-IN 113

Query: 126 RDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGI 185
             R+ D  + L D      ++I++S SG ++++D  +   + +   D   +VVR+F  GI
Sbjct: 114 PARK-DVLVTLEDGRVLPGRLINVSSSGAALAIDHTLSRGASITIGDTAAKVVRVFRDGI 172

Query: 186 AIEFS 190
              F+
Sbjct: 173 GAAFA 177


>gi|254562200|ref|YP_003069295.1| hypothetical protein METDI3807 [Methylobacterium extorquens DM4]
 gi|254269478|emb|CAX25444.1| hypothetical protein METDI3807 [Methylobacterium extorquens DM4]
          Length = 191

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 65/125 (52%), Gaps = 3/125 (2%)

Query: 66  VEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKIT 125
           +  +G++E +VV+   N+ + VR++ S     ++A  ++ LA +     +  RA+ R I 
Sbjct: 56  IRYIGQVEARVVSSGDNQ-FVVRLMASRQRAAEVARTMLALAREQGRTFESARAHPR-IN 113

Query: 126 RDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGI 185
             R+ D  + L D      ++I++S SG ++++D  +   + +   D   +VVR+F  GI
Sbjct: 114 PARK-DVLVTLEDGRVLPGRLINVSSSGAALAIDHTLSRGASITIGDTAAKVVRVFRDGI 172

Query: 186 AIEFS 190
              F+
Sbjct: 173 GATFA 177


>gi|304319827|ref|YP_003853470.1| hypothetical protein PB2503_01247 [Parvularcula bermudensis
           HTCC2503]
 gi|303298730|gb|ADM08329.1| hypothetical protein PB2503_01247 [Parvularcula bermudensis
           HTCC2503]
          Length = 194

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 88/189 (46%), Gaps = 9/189 (4%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           D+R+ +R+ +    RFLL +  E   +V  +S  GL +       L G   IV+V+ +GR
Sbjct: 8   DRRSHRRLPLRSAARFLLPEYGESQALVTNVSLSGLALKSPSRPRL-GVPLIVYVDALGR 66

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +E +VV   S+ G+A+    ++ + R++A K++  A      L   R  G          
Sbjct: 67  LEAEVVRHLSD-GFALVFKFTKEKTRRIARKILAFA------LNQRRGSGLASPTLARAT 119

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDIL-GRVVRIFPGGIAIEFS 190
           + +   D  + +CK+ D S  G  V  + +  + + V+ +  L   VVR    G A+EFS
Sbjct: 120 SPIRYEDGREEACKLRDFSILGAIVESERRPFLGATVIVHGRLEATVVRHLNDGYAVEFS 179

Query: 191 SVQESNIAF 199
              +S   F
Sbjct: 180 QYWQSIPKF 188


>gi|296444790|ref|ZP_06886753.1| type IV pilus assembly PilZ [Methylosinus trichosporium OB3b]
 gi|296257738|gb|EFH04802.1| type IV pilus assembly PilZ [Methylosinus trichosporium OB3b]
          Length = 185

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 78/171 (45%), Gaps = 14/171 (8%)

Query: 23  LKGRFLLFDGTEYNCIVREISPGGLCIVCD-VPMFLVGERSIVFVEKVGRIEGKVVNFDS 81
            KGRF   D  +Y C   ++S   + + CD  P   VG R ++ +E+ G+ EG V+   +
Sbjct: 10  FKGRFTAPDRRDYFCRAIDMSAEVVALRCDYAPD--VGARIVLHLERWGKFEGAVIRVFA 67

Query: 82  NRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDC--RAYGRKITRDREVDAQLVLNDN 139
             G+ V +  ++  R  +A +L WL+     H      R++ R   R R +   +     
Sbjct: 68  G-GFTVGLEVADRGRAHVAMQLAWLSR----HAAGAAFRSHERLTPRRRFITFTV---QG 119

Query: 140 TKHSCKVIDISESGVSVSVDLQIEMFSKV-LFNDILGRVVRIFPGGIAIEF 189
               C+V+D+S SG  +  ++++   + V L    +  V R    G A+ F
Sbjct: 120 VTLPCEVLDLSRSGALLRTEVKVPDGAAVTLGRKTIAEVARQTDQGFAVRF 170


>gi|240136930|ref|YP_002961397.1| Type IV pilus assembly PilZ [Methylobacterium extorquens AM1]
 gi|240006894|gb|ACS38120.1| Type IV pilus assembly PilZ [Methylobacterium extorquens AM1]
          Length = 185

 Score = 42.4 bits (98), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 63/143 (44%), Gaps = 4/143 (2%)

Query: 19  VKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVN 78
           + V L GR LL  G E +C+ R      + +V       VG R I  V+ +G IE  V  
Sbjct: 4   MPVALAGRILLPCGAERDCLCRLSRADEVYVVIGDASAAVGSRVICHVDGLGVIEASVTT 63

Query: 79  FDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLND 138
             S     + +  S     +LA +L W   + D   +D R   R I  D  V  ++ L+D
Sbjct: 64  V-SRGSLRLSVEGSPAHMARLATRLAWHRARLDGR-EDQRGAMRVIPLDPSV--EVTLSD 119

Query: 139 NTKHSCKVIDISESGVSVSVDLQ 161
                 ++ D+S +G ++ + L+
Sbjct: 120 GMAVEARIADLSATGAALEMVLR 142


>gi|218663518|ref|ZP_03519448.1| type IV pilus assembly PilZ [Rhizobium etli IE4771]
          Length = 58

 Score = 41.2 bits (95), Expect = 0.098,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 34/49 (69%)

Query: 145 KVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQ 193
           +++D+S SG +V V+++  + + V   ++ GRVVR F  G+AIEF S+Q
Sbjct: 1   RIMDLSLSGAAVDVEMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLSIQ 49


>gi|163794441|ref|ZP_02188412.1| hypothetical protein BAL199_04489 [alpha proteobacterium BAL199]
 gi|159180165|gb|EDP64688.1| hypothetical protein BAL199_04489 [alpha proteobacterium BAL199]
          Length = 155

 Score = 39.3 bits (90), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 5/80 (6%)

Query: 25  GRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRG 84
           G  L+ DG E + ++ +IS GG+ +V D      G +  V V  VG IE +VV  D +R 
Sbjct: 71  GTALMVDGREVDAVIVDISVGGVGMVTD-EQLPAGTKLRVAVPPVGWIEAEVVATDDDRL 129

Query: 85  YAVRIVT---SENERRKLAD 101
           + VR  T   + +++R L D
Sbjct: 130 H-VRFRTDDATSDQQRALLD 148


>gi|111115563|ref|YP_710181.1| hypothetical protein BAPKO_0777 [Borrelia afzelii PKo]
 gi|216263336|ref|ZP_03435331.1| conserved hypothetical protein [Borrelia afzelii ACA-1]
 gi|110890837|gb|ABH02005.1| hypothetical protein BAPKO_0777 [Borrelia afzelii PKo]
 gi|215980180|gb|EEC21001.1| conserved hypothetical protein [Borrelia afzelii ACA-1]
          Length = 261

 Score = 38.9 bits (89), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 54/102 (52%), Gaps = 11/102 (10%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSI- 63
           IH    +D+ + +++K+D    F+ F+G+++ C+++++S GG  ++       V E +I 
Sbjct: 146 IHERIIVDKDSIRKLKIDSDKAFIKFNGSKHKCLIKDLSYGGALVISSFDYGDVNEDTID 205

Query: 64  -----VFVEKVGRIEGK-----VVNFDSNRGYAVRIVTSENE 95
                 F++K   IEGK     V+   + + +A+ I   E++
Sbjct: 206 LIFSFEFMDKEIFIEGKSKSLSVIQTPNGKVFALGIAFDEDK 247


>gi|218875342|ref|YP_002455270.1| hypothetical protein BbuZS7_F20 [Borrelia burgdorferi ZS7]
 gi|218165296|gb|ACK75352.1| conserved hypothetical protein [Borrelia burgdorferi ZS7]
          Length = 266

 Score = 38.5 bits (88), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 31/46 (67%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIV 50
           IH    +D+ + +R+K+D    F+ F+G+++ C+V+++S GG  ++
Sbjct: 147 IHERIIVDKNSIRRLKIDFDKVFINFNGSKHKCLVKDLSYGGALVI 192


>gi|219724139|ref|YP_002477181.1| hypothetical protein Bbu156a_Y14 [Borrelia burgdorferi 156a]
 gi|224796604|ref|YP_002641665.1| hypothetical protein BBU64B_Y0008 [Borrelia burgdorferi 64b]
 gi|225575846|ref|YP_002724640.1| hypothetical protein BBU118A_Y07 [Borrelia burgdorferi 118a]
 gi|219693143|gb|ACL34347.1| conserved hypothetical protein [Borrelia burgdorferi 156a]
 gi|223929190|gb|ACN23910.1| conserved hypothetical protein [Borrelia burgdorferi 64b]
 gi|225546746|gb|ACN92746.1| conserved hypothetical protein [Borrelia burgdorferi 118a]
 gi|312148289|gb|ADQ30948.1| conserved hypothetical protein [Borrelia burgdorferi JD1]
 gi|312149876|gb|ADQ29942.1| conserved hypothetical protein [Borrelia burgdorferi N40]
          Length = 266

 Score = 38.5 bits (88), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 31/46 (67%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIV 50
           IH    +D+ + +R+K+D    F+ F+G+++ C+V+++S GG  ++
Sbjct: 147 IHERIIVDKNSIRRLKIDFDKVFINFNGSKHKCLVKDLSYGGALVI 192


>gi|224531958|ref|ZP_03672590.1| conserved hypothetical protein [Borrelia valaisiana VS116]
 gi|224511423|gb|EEF81829.1| conserved hypothetical protein [Borrelia valaisiana VS116]
          Length = 261

 Score = 38.5 bits (88), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 54/102 (52%), Gaps = 11/102 (10%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSI- 63
           IH    +D+ + +++K+D    F+ F+G+++ C+++++S GG  ++       V E +I 
Sbjct: 146 IHERIVVDKDSIRKLKIDSDKAFIKFNGSKHKCLIKDLSYGGALVISSFDYGDVKEDAID 205

Query: 64  -----VFVEKVGRIEGK-----VVNFDSNRGYAVRIVTSENE 95
                 F++K   IEGK     V+   + + +A+ I   E++
Sbjct: 206 LIFSFEFMDKEIFIEGKSKSLSVIQTPNGKFFALGIAFDEDK 247


>gi|225551728|ref|ZP_03772671.1| conserved hypothetical protein [Borrelia sp. SV1]
 gi|225371523|gb|EEH00950.1| conserved hypothetical protein [Borrelia sp. SV1]
          Length = 261

 Score = 38.5 bits (88), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 40/72 (55%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           IH    ID+ + +++K+D    F+ F+G ++ C+++++S GG  ++       V E +I 
Sbjct: 146 IHERIIIDKDSIRKLKIDSDKAFIKFNGAKHKCLIKDLSYGGALVISSFDYGDVEEDAID 205

Query: 65  FVEKVGRIEGKV 76
            +     I+G++
Sbjct: 206 LIFSFEFIDGEI 217


>gi|225550005|ref|ZP_03770966.1| conserved hypothetical protein [Borrelia burgdorferi 118a]
 gi|225369464|gb|EEG98916.1| conserved hypothetical protein [Borrelia burgdorferi 118a]
          Length = 261

 Score = 38.1 bits (87), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 40/72 (55%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           IH    ID+ + +++K+D    F+ F+G ++ C+++++S GG  ++       V E +I 
Sbjct: 146 IHERIIIDKDSIRKLKIDSDKAFIKFNGAKHKCLIKDLSYGGALVISSFDYGDVEEDAID 205

Query: 65  FVEKVGRIEGKV 76
            +     I+G++
Sbjct: 206 LIFSFEFIDGEI 217


>gi|195941551|ref|ZP_03086933.1| hypothetical protein Bbur8_01536 [Borrelia burgdorferi 80a]
 gi|216264588|ref|ZP_03436580.1| conserved hypothetical protein [Borrelia burgdorferi 156a]
 gi|218249488|ref|YP_002375232.1| hypothetical protein BbuZS7_0758 [Borrelia burgdorferi ZS7]
 gi|221217947|ref|ZP_03589414.1| conserved hypothetical protein [Borrelia burgdorferi 72a]
 gi|223889507|ref|ZP_03624093.1| conserved hypothetical protein [Borrelia burgdorferi 64b]
 gi|224532618|ref|ZP_03673240.1| conserved hypothetical protein [Borrelia burgdorferi WI91-23]
 gi|224533364|ref|ZP_03673958.1| conserved hypothetical protein [Borrelia burgdorferi CA-11.2a]
 gi|226321226|ref|ZP_03796759.1| conserved hypothetical protein [Borrelia burgdorferi 29805]
 gi|226321431|ref|ZP_03796958.1| conserved hypothetical protein [Borrelia burgdorferi Bol26]
 gi|215981061|gb|EEC21868.1| conserved hypothetical protein [Borrelia burgdorferi 156a]
 gi|218164676|gb|ACK74737.1| conserved hypothetical protein [Borrelia burgdorferi ZS7]
 gi|221192253|gb|EEE18473.1| conserved hypothetical protein [Borrelia burgdorferi 72a]
 gi|223885193|gb|EEF56297.1| conserved hypothetical protein [Borrelia burgdorferi 64b]
 gi|224512474|gb|EEF82853.1| conserved hypothetical protein [Borrelia burgdorferi WI91-23]
 gi|224513529|gb|EEF83886.1| conserved hypothetical protein [Borrelia burgdorferi CA-11.2a]
 gi|226233227|gb|EEH31979.1| conserved hypothetical protein [Borrelia burgdorferi Bol26]
 gi|226233355|gb|EEH32103.1| conserved hypothetical protein [Borrelia burgdorferi 29805]
 gi|312149004|gb|ADQ29075.1| conserved hypothetical protein [Borrelia burgdorferi N40]
          Length = 261

 Score = 38.1 bits (87), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 40/72 (55%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           IH    ID+ + +++K+D    F+ F+G ++ C+++++S GG  ++       V E +I 
Sbjct: 146 IHERIIIDKDSIRKLKIDSDKAFIKFNGAKHKCLIKDLSYGGALVISSFDYGDVEEDAID 205

Query: 65  FVEKVGRIEGKV 76
            +     I+G++
Sbjct: 206 LIFSFEFIDGEI 217


>gi|225548846|ref|ZP_03769823.1| conserved hypothetical protein [Borrelia burgdorferi 94a]
 gi|225370449|gb|EEG99885.1| conserved hypothetical protein [Borrelia burgdorferi 94a]
          Length = 261

 Score = 38.1 bits (87), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 40/72 (55%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           IH    ID+ + +++K+D    F+ F+G ++ C+++++S GG  ++       V E +I 
Sbjct: 146 IHERIIIDKDSIRKLKIDSDKAFIKFNGAKHKCLIKDLSYGGALVISSFDYGDVEEDAID 205

Query: 65  FVEKVGRIEGKV 76
            +     I+G++
Sbjct: 206 LIFSFEFIDGEI 217


>gi|312147769|gb|ADQ30428.1| conserved hypothetical protein [Borrelia burgdorferi JD1]
          Length = 261

 Score = 38.1 bits (87), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 40/72 (55%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           IH    ID+ + +++K+D    F+ F+G ++ C+++++S GG  ++       V E +I 
Sbjct: 146 IHERIIIDKDSIRKLKIDSDKAFIKFNGAKHKCLIKDLSYGGALVISSFDYGDVEEDAID 205

Query: 65  FVEKVGRIEGKV 76
            +     I+G++
Sbjct: 206 LIFSFEFIDGEI 217


>gi|219872305|ref|YP_002476706.1| hypothetical protein BGAPBR_F0004 [Borrelia garinii PBr]
 gi|219694365|gb|ACL34890.1| conserved hypothetical protein [Borrelia garinii PBr]
          Length = 269

 Score = 38.1 bits (87), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 31/47 (65%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVC 51
           IH    +D ++ +++K+D    F+ F+G+++ C+++++S GG  ++ 
Sbjct: 149 IHERIVVDNQSIKQLKIDFDKSFIKFNGSKHKCLIKDLSYGGALVIS 195


>gi|15595078|ref|NP_212867.1| hypothetical protein BB0733 [Borrelia burgdorferi B31]
 gi|2688674|gb|AAC67086.1| predicted coding region BB0733 [Borrelia burgdorferi B31]
          Length = 276

 Score = 38.1 bits (87), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 40/72 (55%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           IH    ID+ + +++K+D    F+ F+G ++ C+++++S GG  ++       V E +I 
Sbjct: 161 IHERIIIDKDSIRKLKIDSDKAFIKFNGAKHKCLIKDLSYGGALVISSFDYGDVEEDAID 220

Query: 65  FVEKVGRIEGKV 76
            +     I+G++
Sbjct: 221 LIFSFEFIDGEI 232


>gi|51598985|ref|YP_073173.1| hypothetical protein BG0755 [Borrelia garinii PBi]
 gi|51573556|gb|AAU07581.1| hypothetical protein BG0755 [Borrelia garinii PBi]
          Length = 261

 Score = 37.7 bits (86), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 53/102 (51%), Gaps = 11/102 (10%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSI- 63
           IH    +D+ + +++K+D    F+ F+G+++ C+++++S GG  ++         E SI 
Sbjct: 146 IHERIIVDKDSIRKLKIDSDKAFIKFNGSKHKCLIKDLSYGGALVISSFDYGDFKEDSID 205

Query: 64  -----VFVEKVGRIEGK-----VVNFDSNRGYAVRIVTSENE 95
                 F++K   IEGK     V+   + + +A+ I   E++
Sbjct: 206 LIFSFEFMDKEIFIEGKSKSLSVIQTPNGKVFALGIAFDEDK 247


>gi|224534524|ref|ZP_03675100.1| conserved hypothetical protein [Borrelia spielmanii A14S]
 gi|224514201|gb|EEF84519.1| conserved hypothetical protein [Borrelia spielmanii A14S]
          Length = 261

 Score = 37.7 bits (86), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 6/77 (7%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           IH    +D+ + +++K+D    F+ F+G+++ C+++++S GG  ++       V E SI 
Sbjct: 146 IHERIIVDKDSIRKLKIDSDKAFIKFNGSKHKCLIKDLSYGGALVISSFDYGDVKEDSID 205

Query: 65  FV---EKVGR---IEGK 75
            +   E +G    IEGK
Sbjct: 206 LIFSFEFMGEEIFIEGK 222


>gi|219684309|ref|ZP_03539253.1| conserved hypothetical protein [Borrelia garinii PBr]
 gi|219685532|ref|ZP_03540349.1| conserved hypothetical protein [Borrelia garinii Far04]
 gi|219672298|gb|EED29351.1| conserved hypothetical protein [Borrelia garinii PBr]
 gi|219672931|gb|EED29953.1| conserved hypothetical protein [Borrelia garinii Far04]
          Length = 261

 Score = 37.7 bits (86), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 53/102 (51%), Gaps = 11/102 (10%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSI- 63
           IH    +D+ + +++K+D    F+ F+G+++ C+++++S GG  ++         E SI 
Sbjct: 146 IHERIIVDKDSIRKLKIDSDKAFIKFNGSKHKCLIKDLSYGGALVISSFDYRDFKEDSID 205

Query: 64  -----VFVEKVGRIEGK-----VVNFDSNRGYAVRIVTSENE 95
                 F++K   IEGK     V+   + + +A+ I   E++
Sbjct: 206 LIFSFEFMDKEIFIEGKSKSLSVIQTPNGKVFALGIAFDEDK 247


>gi|23004164|ref|ZP_00047641.1| COG0532: Translation initiation factor 2 (IF-2; GTPase)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 100

 Score = 35.8 bits (81), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 45/89 (50%), Gaps = 2/89 (2%)

Query: 103 LIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQI 162
           ++ LA++ +  L+  R + R    +R  D  + L D      ++I++S SG ++ ++  +
Sbjct: 1   MLALAHEQERPLEAWRLHARINPVNR--DVLVTLEDGRVLPGRLINVSASGAALVIEDTV 58

Query: 163 EMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           E  + ++      RVVR+F  GI   F +
Sbjct: 59  ERGAHIVIGSTAARVVRVFRDGIGAAFVT 87


>gi|17544424|ref|NP_503014.1| hypothetical protein Y116A8C.11 [Caenorhabditis elegans]
 gi|18203490|sp|Q9U2T3|Y8CB_CAEEL RecName: Full=Uncharacterized protein Y116A8C.11
 gi|5832806|emb|CAB55144.1| C. elegans protein Y116A8C.11, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 281

 Score = 35.8 bits (81), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 35/54 (64%), Gaps = 2/54 (3%)

Query: 58  VGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTS--ENERRKLADKLIWLANK 109
           + E++I    +VG++  ++ +F+S+RGY   ++ S  E ++RKL  +LI L +K
Sbjct: 176 LSEKNIELERQVGKLTAQLQDFESSRGYEQELILSQLEVQKRKLDKQLIDLQSK 229


>gi|270307535|ref|YP_003329593.1| sensor histidine kinase [Dehalococcoides sp. VS]
 gi|270153427|gb|ACZ61265.1| sensor histidine kinase [Dehalococcoides sp. VS]
          Length = 363

 Score = 35.0 bits (79), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 21/26 (80%), Gaps = 1/26 (3%)

Query: 19  VKVDLKGRFLLFDGTEYNC-IVREIS 43
           + V++ G +LLFDG EYNC IVR+I+
Sbjct: 101 IPVEISGNYLLFDGKEYNCGIVRDIT 126


>gi|220924042|ref|YP_002499344.1| type IV pilus assembly PilZ [Methylobacterium nodulans ORS 2060]
 gi|219948649|gb|ACL59041.1| type IV pilus assembly PilZ [Methylobacterium nodulans ORS 2060]
          Length = 200

 Score = 35.0 bits (79), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 81/167 (48%), Gaps = 5/167 (2%)

Query: 23  LKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSN 82
           + GR+LL +G E+ C  R  S     ++  VP  L G+   +++  +G + G V+   + 
Sbjct: 24  ISGRYLLPNGHEHACETRTFSLTEAELIAAVPG-LPGDPVTIYLNTIGAVTG-VIRSLTP 81

Query: 83  RGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKH 142
            G+ V I      R ++A +L WLA +    + D R+  R +   + V  Q+ L D +  
Sbjct: 82  AGFIVAIEIGPGRRARIAARLAWLAARASGKI-DQRSDVRIVPATKAV--QVKLPDGSVL 138

Query: 143 SCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
              +ID+S +G +++V  +  + + V        VVR   GGIA+ F
Sbjct: 139 PGSLIDLSMTGAAIAVAARPAVGATVTVGKRFATVVRHLDGGIAVAF 185


>gi|289193255|ref|YP_003459196.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Methanocaldococcus
           sp. FS406-22]
 gi|288939705|gb|ADC70460.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Methanocaldococcus
           sp. FS406-22]
          Length = 427

 Score = 35.0 bits (79), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 51/115 (44%), Gaps = 6/115 (5%)

Query: 63  IVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLH-LQDCRAYG 121
           ++ V+K  R+EG +V    ++ Y  R V   +    ++  +  L   D L  +  C+  G
Sbjct: 1   MLIVKKTDRLEG-IVKAPPSKSYTHRAVIGASLAEGISRIINPLWGADCLSSVHGCKMLG 59

Query: 122 RKITRDREVDAQLVLNDNTKHSCKVIDISESGVSV----SVDLQIEMFSKVLFND 172
             IT D+E D  +V     K    +IDI  SG ++    S+  QI     +L  D
Sbjct: 60  ADITLDKEKDEWVVKGGELKTPDNIIDIGNSGTTLRILTSIASQIPKGYAILTGD 114


>gi|209867683|gb|ACI90370.1| hypothetical protein [Philodina roseola]
          Length = 493

 Score = 35.0 bits (79), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 3/76 (3%)

Query: 41  EISPGGLCI-VCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKL 99
           EISPG L   + +V +  +G+RS   +E++G + G++V+FD  RG+   +      R +L
Sbjct: 132 EISPGELNFHLVNVKLDELGQRSRKHLEQIGSLIGQLVHFDLLRGHTCYVEMGAG-RGQL 190

Query: 100 ADKL-IWLANKDDLHL 114
           + +L   L   DD+H 
Sbjct: 191 SHELYACLKQHDDVHF 206


>gi|302813838|ref|XP_002988604.1| hypothetical protein SELMODRAFT_427239 [Selaginella moellendorffii]
 gi|300143711|gb|EFJ10400.1| hypothetical protein SELMODRAFT_427239 [Selaginella moellendorffii]
          Length = 2038

 Score = 34.7 bits (78), Expect = 7.5,   Method: Composition-based stats.
 Identities = 28/105 (26%), Positives = 50/105 (47%), Gaps = 6/105 (5%)

Query: 95  ERRKLADKLIWLANKDDLHLQDCRAYGRKIT--RDREVDAQLVLNDNTKHSCKVIDISES 152
           E++KL D   W+  K  L L+  R Y R IT  RD+ ++ +  L    K +   +  SE+
Sbjct: 811 EKKKLEDDREWVDAKHKLELE--RNYARSITSERDKAMERREALGLELKEALAALSASET 868

Query: 153 GVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNI 197
              V+    +E+ + +   D   +++ +  GG  I  S   E+N+
Sbjct: 869 RAKVAEVRSLELEANLRRAD--EKIMAVVAGGKQISGSEDMENNV 911


>gi|209515874|ref|ZP_03264736.1| conserved hypothetical protein [Burkholderia sp. H160]
 gi|209503722|gb|EEA03716.1| conserved hypothetical protein [Burkholderia sp. H160]
          Length = 1107

 Score = 34.7 bits (78), Expect = 7.7,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 97  RKLADKLIWLANKDDLHLQDCRA--YGRKITRDREVDAQLVLNDNTKHSCKV 146
           +K A+  +WL   D+LHL       Y  K+   +E +AQLVL  NT H   V
Sbjct: 426 QKSAENSLWLETSDNLHLTSDTGDRYTIKLRTRQEQNAQLVLKGNTAHFASV 477


Searching..................................................done


Results from round 2




>gi|254780885|ref|YP_003065298.1| hypothetical protein CLIBASIA_03910 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040562|gb|ACT57358.1| hypothetical protein CLIBASIA_03910 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 207

 Score =  277 bits (708), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE 60
           MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE
Sbjct: 1   MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE 60

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAY 120
           RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAY
Sbjct: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAY 120

Query: 121 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI 180
           GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI
Sbjct: 121 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI 180

Query: 181 FPGGIAIEFSSVQESNIAFKSLINHCY 207
           FPGGIAIEFSSVQESNIAFKSLINHCY
Sbjct: 181 FPGGIAIEFSSVQESNIAFKSLINHCY 207


>gi|27380679|ref|NP_772208.1| hypothetical protein blr5568 [Bradyrhizobium japonicum USDA 110]
 gi|27353844|dbj|BAC50833.1| blr5568 [Bradyrhizobium japonicum USDA 110]
          Length = 205

 Score =  274 bits (701), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 76/206 (36%), Positives = 121/206 (58%), Gaps = 8/206 (3%)

Query: 1   MYRGIHNLQFI----DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMF 56
           M   + N +F+    ++R FQRVKV L GR++L D  E+ C V  +SPGGL ++    + 
Sbjct: 1   MKMALANKKFLPAAEERRRFQRVKVHLLGRYMLPDRREFPCQVINMSPGGLALLAPG-IG 59

Query: 57  LVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQD 116
            VG+R + +++ +GR+EGK+     N G+A+ I  +  +R KLA +L WLAN+D L+L +
Sbjct: 60  NVGDRVVAYLDHIGRVEGKITRIIDN-GFAMTIGATPRKRDKLAAQLTWLANRDILNLPE 118

Query: 117 CRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGR 176
            R + R + R+    A L L D TK +C++ID+S SG +++ + +  + S VL   + GR
Sbjct: 119 DRRHDRIVPRNP--IAVLTLEDGTKMTCRIIDLSLSGAAIAAENRPPLKSIVLLGRVQGR 176

Query: 177 VVRIFPGGIAIEFSSVQESNIAFKSL 202
           VVR    G A+EF   Q      +S+
Sbjct: 177 VVRNLEDGFALEFMHEQPIETLEESV 202


>gi|86749268|ref|YP_485764.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris HaA2]
 gi|86572296|gb|ABD06853.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 203

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 67/191 (35%), Positives = 114/191 (59%), Gaps = 4/191 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R FQRVK+ L GR++L D  E+ C V  +SPGGL ++    +  VG+R I +++ +GR
Sbjct: 14  ERRRFQRVKIHLLGRYMLPDRREFPCQVINMSPGGLAMLAPG-IGNVGDRVIAYLDHIGR 72

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EGK+     N G+A+ +  +  +R KLA +L WLAN+D L+L + R + R + R+    
Sbjct: 73  VEGKITRIIDN-GFAMTVGATPRKRDKLAAQLTWLANRDILNLPEDRRHDRIVPRNP--I 129

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           + L L D ++ +C++ID+S SG +++ + +    ++VL   +  RVVR    G A+EF  
Sbjct: 130 SVLTLEDGSRMTCRIIDMSRSGAAIAAEQRPPTDTQVLLGRVAARVVRHLDDGFALEFVH 189

Query: 192 VQESNIAFKSL 202
            Q  +    S+
Sbjct: 190 EQNEDTLEDSV 200


>gi|148256529|ref|YP_001241114.1| hypothetical protein BBta_5217 [Bradyrhizobium sp. BTAi1]
 gi|146408702|gb|ABQ37208.1| hypothetical protein BBta_5217 [Bradyrhizobium sp. BTAi1]
          Length = 202

 Score =  270 bits (690), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 76/193 (39%), Positives = 117/193 (60%), Gaps = 4/193 (2%)

Query: 10  FIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKV 69
             ++R FQRVKV L GR++L D  E+ C V  +SPGGL ++    +  VG+R I +++ +
Sbjct: 11  AEERRRFQRVKVHLLGRYMLPDRREFPCQVINMSPGGLALLAPG-IGNVGDRVIAYLDHI 69

Query: 70  GRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDRE 129
           GR+EGK+     N G+A+ I  +  +R KLA +L WLAN+D L+L + R + R I R+  
Sbjct: 70  GRVEGKITRIIDN-GFAMTIGATARKRDKLAAQLTWLANRDILNLPEDRRHDRIIPRNP- 127

Query: 130 VDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
             A L L D TK +C++ID+S SG +++ + +  M S+V+   +  RVVR   GG AIEF
Sbjct: 128 -IAVLTLEDGTKMTCRIIDMSLSGAAIAAETRPPMKSQVMLGRVQARVVRNLEGGFAIEF 186

Query: 190 SSVQESNIAFKSL 202
              Q +    +S+
Sbjct: 187 VHPQLAETLEESV 199



 Score = 48.7 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 35/81 (43%), Gaps = 8/81 (9%)

Query: 112 LHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVL-- 169
              ++ R + R       +  + +L D  +  C+VI++S  G+++       +  +V+  
Sbjct: 9   PAAEERRRFQRV---KVHLLGRYMLPDRREFPCQVINMSPGGLALLAPGIGNVGDRVIAY 65

Query: 170 ---FNDILGRVVRIFPGGIAI 187
                 + G++ RI   G A+
Sbjct: 66  LDHIGRVEGKITRIIDNGFAM 86


>gi|146339954|ref|YP_001205002.1| hypothetical protein BRADO2958 [Bradyrhizobium sp. ORS278]
 gi|146192760|emb|CAL76765.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 202

 Score =  268 bits (686), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 76/193 (39%), Positives = 117/193 (60%), Gaps = 4/193 (2%)

Query: 10  FIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKV 69
             ++R FQRVKV L GR++L D  EY C V  +SPGGL ++    +  VG+R I +++ +
Sbjct: 11  AEERRRFQRVKVHLLGRYMLPDRREYPCQVINMSPGGLALLAPG-IGNVGDRVIAYLDHI 69

Query: 70  GRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDRE 129
           GR+EGK+     N G+A+ I  +  +R KLA +L WLAN+D L+L + R + R I R+  
Sbjct: 70  GRVEGKITRIIDN-GFAMTIGATARKRDKLAAQLTWLANRDILNLPEDRRHDRIIPRNP- 127

Query: 130 VDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
             A L L D TK +C++ID+S SG +++ + +  M S+V+   +  RV+R   GG AIEF
Sbjct: 128 -IAVLTLEDGTKMTCRIIDMSLSGAAIAAETKPAMKSQVMLGRVQARVIRNLEGGFAIEF 186

Query: 190 SSVQESNIAFKSL 202
              Q +    +S+
Sbjct: 187 MHPQLAETLEESV 199



 Score = 51.0 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 37/85 (43%), Gaps = 8/85 (9%)

Query: 108 NKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSK 167
            +     ++ R + R       +  + +L D  ++ C+VI++S  G+++       +  +
Sbjct: 5   KQSLPAAEERRRFQRV---KVHLLGRYMLPDRREYPCQVINMSPGGLALLAPGIGNVGDR 61

Query: 168 VL-----FNDILGRVVRIFPGGIAI 187
           V+        + G++ RI   G A+
Sbjct: 62  VIAYLDHIGRVEGKITRIIDNGFAM 86


>gi|316933323|ref|YP_004108305.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris DX-1]
 gi|315601037|gb|ADU43572.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris DX-1]
          Length = 203

 Score =  266 bits (680), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 71/192 (36%), Positives = 116/192 (60%), Gaps = 4/192 (2%)

Query: 11  IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
           +++R FQRVKV L GR++L D  E+ C V  +SPGGL ++    +  VG+R I +++ VG
Sbjct: 13  LERRRFQRVKVHLLGRYMLPDRREFPCQVINMSPGGLAMLAPG-IGNVGDRVIAYLDHVG 71

Query: 71  RIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREV 130
           R+EGK+     N G+A+ +  +  +R KLA +L WLAN+D L+L + R + R + R+   
Sbjct: 72  RVEGKITRIIDN-GFAMTLAATPRKRDKLAAQLTWLANRDILNLPEDRRHDRIVPRNP-- 128

Query: 131 DAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFS 190
            A L L+D ++ SC++ID+S SG +++ + +  + ++VL   +  RVVR    G A+EF 
Sbjct: 129 IAILTLDDGSRMSCRIIDMSRSGAAIAAEHRPPLHAQVLLGRVASRVVRHLDDGFALEFI 188

Query: 191 SVQESNIAFKSL 202
             Q       S+
Sbjct: 189 HEQLEETLEDSV 200


>gi|90424624|ref|YP_532994.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisB18]
 gi|90106638|gb|ABD88675.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisB18]
          Length = 204

 Score =  266 bits (680), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 72/191 (37%), Positives = 114/191 (59%), Gaps = 4/191 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R FQRVKV L GR++L D  E+ C V  +SPGGL ++    +  VG+R I +++ +GR
Sbjct: 15  ERRRFQRVKVHLLGRYMLPDRREFPCQVINMSPGGLAMLAPG-IGNVGDRVIAYLDHIGR 73

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EGK+     N G+A+ +  +  +R KLA +L WLAN+D L+L + R + R + R+    
Sbjct: 74  VEGKITRIIDN-GFAMTVGATPRKRDKLAAQLTWLANRDILNLPEDRRHDRIVPRNP--I 130

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           + L L D +K SC++ID+S SG ++S D +  + S+V    +  RVVR    G A+EF  
Sbjct: 131 SILTLEDGSKQSCRIIDMSRSGAAISADFRPTLNSQVALGRVQARVVRHLDDGFALEFIH 190

Query: 192 VQESNIAFKSL 202
            Q +     S+
Sbjct: 191 EQIAETLEDSV 201


>gi|91977744|ref|YP_570403.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisB5]
 gi|91684200|gb|ABE40502.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisB5]
          Length = 203

 Score =  265 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 68/191 (35%), Positives = 113/191 (59%), Gaps = 4/191 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R FQRVK+ L GR++L D  E+ C V  +SPGGL ++    +  VG+R I +++ +GR
Sbjct: 14  ERRRFQRVKLHLLGRYMLPDRREFPCQVINMSPGGLAMLAPG-IGNVGDRVIAYLDHIGR 72

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EGK+     N G+A+ +  +  +R KLA +L WLAN+D L+L + R + R + R+    
Sbjct: 73  VEGKITRIIDN-GFAMTVGATPRKRDKLAAQLTWLANRDILNLPEDRRHDRIVPRNP--I 129

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           + L L D ++ +C++ID+S SG +++ + +  M S+V    +  RVVR    G A+EF  
Sbjct: 130 SLLTLQDGSRMTCRIIDMSRSGAAIAAEHRPPMNSQVSLGRVQARVVRYLEDGFALEFVH 189

Query: 192 VQESNIAFKSL 202
            Q       S+
Sbjct: 190 EQLEETLEDSV 200


>gi|85715638|ref|ZP_01046618.1| hypothetical protein NB311A_18356 [Nitrobacter sp. Nb-311A]
 gi|85697577|gb|EAQ35454.1| hypothetical protein NB311A_18356 [Nitrobacter sp. Nb-311A]
          Length = 202

 Score =  265 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 73/198 (36%), Positives = 119/198 (60%), Gaps = 5/198 (2%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           I NL   ++R FQRVK+ L GR++L D  E+ C V  +SPGGL ++    +  VG+R + 
Sbjct: 7   ISNLPA-ERRRFQRVKIHLLGRYMLPDRREFPCQVINMSPGGLAMLAPG-IGNVGDRVVA 64

Query: 65  FVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKI 124
           +++ +GR+EGKV     + G+A+ I  +  +R KLA +L WLAN+D L+L + R + R +
Sbjct: 65  YLDHIGRVEGKVTRII-DSGFAMNISATPRKRDKLASQLTWLANRDILNLPEDRRHDRIV 123

Query: 125 TRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGG 184
            R+    A L L D T+ +C+++D+S+SG +VS + +  + S+V    +L RVVR    G
Sbjct: 124 PRNP--VANLTLEDGTQLTCRILDLSKSGAAVSAEKRPPLRSRVALGKVLARVVRYLEEG 181

Query: 185 IAIEFSSVQESNIAFKSL 202
            A+EF   Q  +    ++
Sbjct: 182 FALEFIHEQHPDTLEDNV 199


>gi|192292269|ref|YP_001992874.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris TIE-1]
 gi|192286018|gb|ACF02399.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris TIE-1]
          Length = 203

 Score =  265 bits (678), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 71/192 (36%), Positives = 116/192 (60%), Gaps = 4/192 (2%)

Query: 11  IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
           +++R FQRVKV L GR++L D  E+ C V  +SPGGL ++    +  VG+R I +++ VG
Sbjct: 13  LERRRFQRVKVHLLGRYMLPDRREFPCQVINMSPGGLALLAPG-IGNVGDRVIAYLDHVG 71

Query: 71  RIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREV 130
           R+EGK+     N G+A+ +  +  +R KLA +L WLAN+D L+L + R + R + R+   
Sbjct: 72  RVEGKITRIIDN-GFAMTVAATPRKRDKLAAQLTWLANRDILNLPEDRRHDRIVPRNP-- 128

Query: 131 DAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFS 190
            A L L+D ++ SC++ID+S SG +++ + +  + ++VL   +  RVVR    G A+EF 
Sbjct: 129 IAVLTLDDGSRMSCRIIDMSRSGAAIAAEQRPPLNAQVLLGRVASRVVRHLDDGFALEFV 188

Query: 191 SVQESNIAFKSL 202
             Q       S+
Sbjct: 189 HEQLEETLEDSV 200


>gi|328543254|ref|YP_004303363.1| Type IV pilus assembly PilZ [polymorphum gilvum SL003B-26A1]
 gi|326413000|gb|ADZ70063.1| Type IV pilus assembly PilZ [Polymorphum gilvum SL003B-26A1]
          Length = 212

 Score =  264 bits (674), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 61/196 (31%), Positives = 118/196 (60%), Gaps = 4/196 (2%)

Query: 7   NLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFV 66
             + ID+R  QRV +++ GRF+L +  EY C V  +SPGG+ ++  V    VGER + ++
Sbjct: 14  TAKGIDRRRHQRVAINVLGRFMLENRQEYPCQVINMSPGGVAMITPVS-GRVGERVVAYL 72

Query: 67  EKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITR 126
           + +GR+EG +       G+A+ +  ++ +R KLA+ L WLAN+++L+L + R + R + +
Sbjct: 73  DHIGRVEGTIAREIEG-GFAIALHNTQRKRDKLANILTWLANRNELNLPEDRRHDRFVPK 131

Query: 127 DREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIA 186
           +     ++VL D T   C+++D+S SG +++   +  + ++V    +  R+VR    GIA
Sbjct: 132 NPMT--RMVLPDGTSFMCRLLDVSLSGAALACTARPPLGTEVALGKMRARIVRHTEDGIA 189

Query: 187 IEFSSVQESNIAFKSL 202
           +EF+++Q  ++  + +
Sbjct: 190 VEFAAIQNRDLLEQHI 205



 Score = 55.2 bits (132), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 40/93 (43%), Gaps = 8/93 (8%)

Query: 116 DCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVL-----F 170
           D R + R       V  + +L +  ++ C+VI++S  GV++   +   +  +V+      
Sbjct: 19  DRRRHQRVA---INVLGRFMLENRQEYPCQVINMSPGGVAMITPVSGRVGERVVAYLDHI 75

Query: 171 NDILGRVVRIFPGGIAIEFSSVQESNIAFKSLI 203
             + G + R   GG AI   + Q       +++
Sbjct: 76  GRVEGTIAREIEGGFAIALHNTQRKRDKLANIL 108


>gi|92118084|ref|YP_577813.1| hypothetical protein Nham_2571 [Nitrobacter hamburgensis X14]
 gi|91800978|gb|ABE63353.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 202

 Score =  264 bits (674), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 66/192 (34%), Positives = 115/192 (59%), Gaps = 4/192 (2%)

Query: 11  IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
           +++R FQRV+V L GR++L D  E+ C +  +SPGGL ++    +  VG+R +V+++ +G
Sbjct: 12  VERRRFQRVRVHLLGRYMLPDRREFPCQIINMSPGGLAMLAPG-IGNVGDRVVVYLDHIG 70

Query: 71  RIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREV 130
           R+EGK+     + G+A+ +  +  +R +LA +L WLAN+D L+L + R + R + R    
Sbjct: 71  RVEGKITRII-DSGFAMSVGATPRKRDRLAAQLTWLANRDILNLPEDRRHDRIVPRSP-- 127

Query: 131 DAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFS 190
              L L D T+ +C++ID+S SG ++S + +  + S+V    +L RVVR    G A+EF 
Sbjct: 128 ITTLTLEDGTRMTCRIIDLSMSGAAISAETRPPLQSRVALGKVLARVVRNLEDGFALEFV 187

Query: 191 SVQESNIAFKSL 202
             Q  +    ++
Sbjct: 188 HEQHPDTLEDNV 199


>gi|254470288|ref|ZP_05083692.1| type IV pilus assembly PilZ [Pseudovibrio sp. JE062]
 gi|211960599|gb|EEA95795.1| type IV pilus assembly PilZ [Pseudovibrio sp. JE062]
          Length = 211

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 66/193 (34%), Positives = 118/193 (61%), Gaps = 4/193 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           D+R F RV++++ GRF+L +  EY C V  +SPGG   +  V M  +GER + +++ +GR
Sbjct: 19  DRRRFSRVEINVLGRFMLENRREYPCQVVNMSPGGAAFISPV-MGEIGERVVAYLDHIGR 77

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EGK+V      G+A+ +  S  +R KLA  L WLANKD+L+L + R + R + ++    
Sbjct: 78  VEGKIVREIDG-GFAMTVNASARKRDKLASVLTWLANKDELNLPEDRRFDRFVPKNPMT- 135

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
            +++L D  +++C+++D+S SG ++  D++  + + +    +  R+VR F  GIA+EF++
Sbjct: 136 -KIILPDGREYACRIVDVSLSGAALKTDVRPALGTPITLGKMRARIVRHFEEGIAVEFAT 194

Query: 192 VQESNIAFKSLIN 204
           VQ   +    + N
Sbjct: 195 VQNKELLEHHISN 207


>gi|115524336|ref|YP_781247.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisA53]
 gi|115518283|gb|ABJ06267.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisA53]
          Length = 222

 Score =  262 bits (669), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 71/194 (36%), Positives = 118/194 (60%), Gaps = 4/194 (2%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEK 68
           +  ++R FQRVK+ L GR++L D  E+ C V ++SPGGL ++    +  VG+R I +++ 
Sbjct: 30  RTEERRRFQRVKLHLLGRYMLPDRREFPCQVIDMSPGGLAMLAPG-IGNVGDRVIAYLDH 88

Query: 69  VGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDR 128
           +GR+EGK+     N G+A+ +  +  +R KLA +L WLAN+D L+L + R + R + R+ 
Sbjct: 89  IGRVEGKITRIIDN-GFAMTVGATPRKRDKLAAQLTWLANRDILNLPEDRRHDRLVPRNP 147

Query: 129 EVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIE 188
              A L + D +KHSC++ID+S SG ++S + +  + ++VL   +  RVVR    G A+E
Sbjct: 148 --IAMLSMQDGSKHSCRIIDMSRSGAAISAEFRPPLQAEVLLGRVQARVVRHLEDGFALE 205

Query: 189 FSSVQESNIAFKSL 202
           F   Q  +    S+
Sbjct: 206 FVHEQLEDTLEDSV 219


>gi|75676353|ref|YP_318774.1| hypothetical protein Nwi_2168 [Nitrobacter winogradskyi Nb-255]
 gi|74421223|gb|ABA05422.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 214

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 71/192 (36%), Positives = 115/192 (59%), Gaps = 4/192 (2%)

Query: 11  IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
           +++R FQRV+V L GR++L D  E+ C V  +SPGGL ++    +  VG+R IV+++ +G
Sbjct: 24  VERRRFQRVRVHLLGRYMLPDRREFPCQVINMSPGGLAMLAPG-IGHVGDRVIVYLDHIG 82

Query: 71  RIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREV 130
           R+EG++     + G+A+ I  +  +R KLA +L WLAN+D L+L + R + R + R+   
Sbjct: 83  RVEGRITRII-DSGFAMNISATPRKRDKLASQLTWLANRDILNLPEDRRHDRIMPRNP-- 139

Query: 131 DAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFS 190
            A L L D T+ +C++ID+S SG +VS +    + S+V    +L RVVR    G A+EF 
Sbjct: 140 IAILTLEDGTRMTCRIIDLSMSGAAVSAEKTPPLQSRVALGKVLSRVVRNLEEGFALEFI 199

Query: 191 SVQESNIAFKSL 202
             Q  +     +
Sbjct: 200 HEQHPDTLEDDV 211


>gi|209884668|ref|YP_002288525.1| type IV pilus assembly PilZ [Oligotropha carboxidovorans OM5]
 gi|209872864|gb|ACI92660.1| type IV pilus assembly PilZ [Oligotropha carboxidovorans OM5]
          Length = 204

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 65/186 (34%), Positives = 111/186 (59%), Gaps = 4/186 (2%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEK 68
           Q  ++R FQRV++ L GR++L D  EY C    +SPGGL ++    +  +GER + +++ 
Sbjct: 11  QAEERRRFQRVRIHLLGRYMLSDRREYPCQAINMSPGGLALLAPG-IGSIGERVVAYLDH 69

Query: 69  VGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDR 128
           +GR+EGK+     N G+A+ +  +  +R KLA +L WLAN++ L+L + R + R + R+ 
Sbjct: 70  IGRVEGKITRLLDN-GFAMTVNATPRKREKLAAQLTWLANREILNLPEDRRHDRIVPRN- 127

Query: 129 EVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIE 188
                L L+D ++  C++ID+S SG ++S  ++  + + V+   +  RVVR    G AIE
Sbjct: 128 -ASGLLKLSDGSEMPCRIIDLSLSGAALSGAMRPLVGTDVMLGRVAARVVRHLEEGFAIE 186

Query: 189 FSSVQE 194
           F+  Q 
Sbjct: 187 FNHPQS 192



 Score = 47.9 bits (113), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 14/85 (16%), Positives = 37/85 (43%), Gaps = 8/85 (9%)

Query: 108 NKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSK 167
            K     ++ R + R       +  + +L+D  ++ C+ I++S  G+++       +  +
Sbjct: 6   RKFQPQAEERRRFQRV---RIHLLGRYMLSDRREYPCQAINMSPGGLALLAPGIGSIGER 62

Query: 168 VL-----FNDILGRVVRIFPGGIAI 187
           V+        + G++ R+   G A+
Sbjct: 63  VVAYLDHIGRVEGKITRLLDNGFAM 87


>gi|118591266|ref|ZP_01548665.1| type IV pilus assembly PilZ [Stappia aggregata IAM 12614]
 gi|118436342|gb|EAV42984.1| type IV pilus assembly PilZ [Stappia aggregata IAM 12614]
          Length = 213

 Score =  260 bits (666), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 70/199 (35%), Positives = 121/199 (60%), Gaps = 4/199 (2%)

Query: 4   GIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSI 63
           G  +LQ  D+R  QRV+V++ GRF+L D  EY C V ++SPGG+ ++  V    VGER I
Sbjct: 13  GSRSLQVTDRRRHQRVQVNILGRFMLEDRREYPCQVIDMSPGGMAMITPV-TGRVGERVI 71

Query: 64  VFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRK 123
            +++ + R+EG +       G+AV +  +  +R K+A+ L WLAN+D+L+L + R + R 
Sbjct: 72  AYLDHLSRVEGTISRLIDG-GFAVELRNTVRKRDKIANVLTWLANRDELNLPEDRRHDRF 130

Query: 124 ITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPG 183
           + ++     +++L D ++H C++ID+S SG +++ D+  EM   +    +  RV+R   G
Sbjct: 131 VPKNPMT--KMILPDGSEHVCRIIDVSLSGAAIATDILPEMGDPITLGKMHARVIRRIEG 188

Query: 184 GIAIEFSSVQESNIAFKSL 202
           GIA+EF++VQ   +    +
Sbjct: 189 GIAVEFAAVQSRELLEHHI 207


>gi|254504045|ref|ZP_05116196.1| Type IV pilus assembly protein PilZ [Labrenzia alexandrii DFL-11]
 gi|222440116|gb|EEE46795.1| Type IV pilus assembly protein PilZ [Labrenzia alexandrii DFL-11]
          Length = 212

 Score =  260 bits (665), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 70/199 (35%), Positives = 123/199 (61%), Gaps = 4/199 (2%)

Query: 4   GIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSI 63
           G  +LQ  D+R  QRV+V++ GRF+L D  EY C V ++SPGG+ ++  V    VGER +
Sbjct: 12  GSKSLQVTDRRRHQRVQVNILGRFMLEDRREYPCQVIDMSPGGMAMITPVS-GKVGERVV 70

Query: 64  VFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRK 123
            +++ + R+EG++       G+AV +  +  +R K+A+ L WLAN+D+L+L + R + R 
Sbjct: 71  AYLDHLSRVEGRISRLIDG-GFAVELRNTVRKRDKIANVLTWLANRDELNLPEDRRHDRF 129

Query: 124 ITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPG 183
           + +++    +++L D T+H C++ D+S SG +++ D+  EM  ++    +  RVVR   G
Sbjct: 130 VPKNQMT--KMILPDGTEHVCRIFDVSLSGAAIATDILPEMGDQITLGKMRARVVRQIEG 187

Query: 184 GIAIEFSSVQESNIAFKSL 202
           GIA+EF++VQ   +    +
Sbjct: 188 GIAVEFAAVQSRELLEHHI 206


>gi|299135313|ref|ZP_07028504.1| type IV pilus assembly PilZ [Afipia sp. 1NLS2]
 gi|298590290|gb|EFI50494.1| type IV pilus assembly PilZ [Afipia sp. 1NLS2]
          Length = 204

 Score =  257 bits (658), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 67/185 (36%), Positives = 109/185 (58%), Gaps = 4/185 (2%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEK 68
           Q  ++R FQRVK+ L GR++L D  EY C    +SPGGL ++    +  +GER + +++ 
Sbjct: 11  QAEERRHFQRVKIHLLGRYMLSDRREYPCQAINMSPGGLALLAPG-IGNLGERVVAYLDH 69

Query: 69  VGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDR 128
           +GR+EGK+     N G+A+ +  +  +R KLA +L WLAN++ L+L + R + R + R+ 
Sbjct: 70  IGRVEGKITRLLDN-GFAMTVSATPRKREKLAAQLTWLANREILNLPEDRRHDRIVPRNA 128

Query: 129 EVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIE 188
                L L    +  C++ID+S SG ++S  ++ E+ S V+   +  RVVR    G AIE
Sbjct: 129 M--GWLRLEGGGEMQCRIIDLSLSGAALSGQMRPEVGSHVMLGRVAARVVRHLEEGFAIE 186

Query: 189 FSSVQ 193
           F+  Q
Sbjct: 187 FNHPQ 191


>gi|319783235|ref|YP_004142711.1| type IV pilus assembly PilZ [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169123|gb|ADV12661.1| type IV pilus assembly PilZ [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 205

 Score =  255 bits (652), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 68/185 (36%), Positives = 115/185 (62%), Gaps = 4/185 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R FQRV+V + GRF+L D TE+ C V ++SPG +    D  + + GE+ I +++ +GR
Sbjct: 14  ERRNFQRVRVKIYGRFMLEDRTEHPCQVVDMSPGNVAFRTD-RIGMPGEKIIAYIDHIGR 72

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           IEG V     + G+A+ ++ S+ ++ KLA +L WLANK +L L + R + R   R+    
Sbjct: 73  IEGVVTRTLQD-GFAMTVIASDRKKDKLAAQLTWLANKHELDLPEDRRHERVAPRNP--T 129

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           + L L D  ++ C++ID+S SG +V +D++  +  +V+   + G+VVR F  G+AIEF+ 
Sbjct: 130 SVLQLTDGRQYQCRIIDLSLSGAAVEIDVKPAIGIQVMLGTMRGQVVRHFEDGVAIEFAV 189

Query: 192 VQESN 196
           +Q   
Sbjct: 190 IQRPE 194



 Score = 41.8 bits (97), Expect = 0.052,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 38/90 (42%), Gaps = 8/90 (8%)

Query: 6   HNLQFIDQRAFQRVKVDLKGRFL-LFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           H L   + R  +RV        L L DG +Y C + ++S  G  +  DV    +G + + 
Sbjct: 110 HELDLPEDRRHERVAPRNPTSVLQLTDGRQYQCRIIDLSLSGAAVEIDVKPA-IGIQVM- 167

Query: 65  FVEKVGRIEGKVVNFDSNRGYAVRIVTSEN 94
               +G + G+VV    + G A+     + 
Sbjct: 168 ----LGTMRGQVVRHFED-GVAIEFAVIQR 192


>gi|13470468|ref|NP_102037.1| hypothetical protein mll0185 [Mesorhizobium loti MAFF303099]
 gi|14021210|dbj|BAB47823.1| mll0185 [Mesorhizobium loti MAFF303099]
          Length = 205

 Score =  254 bits (650), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 66/185 (35%), Positives = 115/185 (62%), Gaps = 4/185 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R FQRV+V + GRF+L D TE+ C V ++SPG +    D  + + GE+ I +++ +GR
Sbjct: 14  ERRNFQRVRVKIYGRFMLEDRTEHPCQVVDMSPGNVAFRTD-RIGMPGEKVIAYIDHIGR 72

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           IEG V     + G+A+ ++ S+ ++ KLA +L WLANK +L L + R + R   R+    
Sbjct: 73  IEGVVTRTLQD-GFAMTVIASDRKKDKLAAQLTWLANKHELDLPEDRRHERVAPRNP--T 129

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           + L L D  ++ C++ID+S SG ++ +D++  +  +V+   + G++VR F  G+AIEF+ 
Sbjct: 130 SVLQLTDGRQYQCRIIDLSLSGAAIEIDVKPAIGVQVMLGTMRGQIVRHFEDGVAIEFAV 189

Query: 192 VQESN 196
           +Q   
Sbjct: 190 IQRPE 194



 Score = 42.9 bits (100), Expect = 0.028,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 38/90 (42%), Gaps = 8/90 (8%)

Query: 6   HNLQFIDQRAFQRVKVDLKGRFL-LFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           H L   + R  +RV        L L DG +Y C + ++S  G  I  DV    +G + + 
Sbjct: 110 HELDLPEDRRHERVAPRNPTSVLQLTDGRQYQCRIIDLSLSGAAIEIDVKPA-IGVQVM- 167

Query: 65  FVEKVGRIEGKVVNFDSNRGYAVRIVTSEN 94
               +G + G++V    + G A+     + 
Sbjct: 168 ----LGTMRGQIVRHFED-GVAIEFAVIQR 192


>gi|260460730|ref|ZP_05808980.1| type IV pilus assembly PilZ [Mesorhizobium opportunistum WSM2075]
 gi|259033307|gb|EEW34568.1| type IV pilus assembly PilZ [Mesorhizobium opportunistum WSM2075]
          Length = 205

 Score =  254 bits (649), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 67/185 (36%), Positives = 114/185 (61%), Gaps = 4/185 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R FQRV+V + GRF+L D TE+ C V ++SPG +    D  + + GE+ I +++ +GR
Sbjct: 14  ERRNFQRVRVKIYGRFMLEDRTEHPCQVVDMSPGNVAFRTD-RIGMPGEKVIAYIDHIGR 72

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           IEG V     + G+A+ ++ S+ ++ KLA +L WLANK +L L + R + R   R+    
Sbjct: 73  IEGVVTRTLQD-GFAMTVIASDRKKDKLAAQLTWLANKHELDLPEDRRHERVAPRNP--T 129

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           + L L D  ++ C++ID+S SG +V +D++  +  +V    + G++VR F  G+AIEF+ 
Sbjct: 130 SVLQLTDGRQYQCRIIDLSLSGAAVEIDVKPAIGVQVTLGTMRGQIVRHFEDGVAIEFAV 189

Query: 192 VQESN 196
           +Q   
Sbjct: 190 IQRPE 194



 Score = 43.3 bits (101), Expect = 0.020,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 37/90 (41%), Gaps = 8/90 (8%)

Query: 6   HNLQFIDQRAFQRVKVDLKGRFL-LFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           H L   + R  +RV        L L DG +Y C + ++S  G  +  DV    +G +   
Sbjct: 110 HELDLPEDRRHERVAPRNPTSVLQLTDGRQYQCRIIDLSLSGAAVEIDVKPA-IGVQVT- 167

Query: 65  FVEKVGRIEGKVVNFDSNRGYAVRIVTSEN 94
               +G + G++V    + G A+     + 
Sbjct: 168 ----LGTMRGQIVRHFED-GVAIEFAVIQR 192


>gi|307945505|ref|ZP_07660841.1| type IV pilus assembly PilZ [Roseibium sp. TrichSKD4]
 gi|307771378|gb|EFO30603.1| type IV pilus assembly PilZ [Roseibium sp. TrichSKD4]
          Length = 216

 Score =  253 bits (647), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 73/197 (37%), Positives = 119/197 (60%), Gaps = 4/197 (2%)

Query: 6   HNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVF 65
             LQ +D+R  QRVKV++ GR++L D  EY C V ++SPGG+ ++  V    VGER + +
Sbjct: 15  RTLQALDKRRHQRVKVNILGRYMLEDRREYPCQVIDMSPGGMALIAPVS-GQVGERIVAY 73

Query: 66  VEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKIT 125
           ++++ R+EGK+       G+AV +  S  +R K+A  L WLANK+ L L + R + R I 
Sbjct: 74  LDQMSRVEGKITRTFDG-GFAVELRNSVRKRDKIASILTWLANKEALDLPEDRRHDRFIP 132

Query: 126 RDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGI 185
           ++     ++ L D T+H+C++ D+S SG ++S DL +E    +    +  RVVR   GGI
Sbjct: 133 KN--TLTRIKLPDGTEHTCRISDLSLSGAAISTDLDVEAGDAIEIGKMSARVVRRIEGGI 190

Query: 186 AIEFSSVQESNIAFKSL 202
           A+EF  VQ  ++  +++
Sbjct: 191 AVEFGEVQNRDLLERTI 207


>gi|222086060|ref|YP_002544592.1| hypothetical protein Arad_2484 [Agrobacterium radiobacter K84]
 gi|221723508|gb|ACM26664.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 209

 Score =  251 bits (642), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 72/191 (37%), Positives = 115/191 (60%), Gaps = 4/191 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           DQR FQRV ++++GR +L    EY C+V E+SPG + + C +      ER + +++ +GR
Sbjct: 23  DQRTFQRVPINMQGRLMLASYEEYECLVTEMSPGDMYVTC-LGRPRANERIVAYIDHLGR 81

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG VV  D  RG+++ I  ++ +R KLA +L WLANK +L L + R + R   R     
Sbjct: 82  VEGNVVAVD-GRGFSMSINATDRKREKLAAQLTWLANKHELGLPEDRRHDRLTPR--STT 138

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
           ++L L D T + C+++D+S SG +V V+ +  + + V   ++ GRVVR F  G+AIEF S
Sbjct: 139 SELTLEDGTLYVCRIMDLSLSGAAVDVEARPPIGTPVRLGNMRGRVVRHFMEGVAIEFLS 198

Query: 192 VQESNIAFKSL 202
           +Q      + L
Sbjct: 199 LQSRETLREFL 209


>gi|39936483|ref|NP_948759.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris CGA009]
 gi|39650339|emb|CAE28861.1| conserved unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 183

 Score =  250 bits (640), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 66/184 (35%), Positives = 109/184 (59%), Gaps = 4/184 (2%)

Query: 19  VKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVN 78
           +KV L GR++L D  E+ C V  +SPGGL ++    +  VG+R I +++ VGR+EGK+  
Sbjct: 1   MKVHLLGRYMLPDRREFPCQVINMSPGGLALLAPG-IGNVGDRVIAYLDHVGRVEGKITR 59

Query: 79  FDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLND 138
              N G+A+ +  +  +R KLA +L WLAN+D L+L + R + R + R+    A L L+D
Sbjct: 60  IIDN-GFAMTVAATPRKRDKLAAQLTWLANRDILNLPEDRRHDRIVPRNP--IAVLTLDD 116

Query: 139 NTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIA 198
            ++ SC++ID+S SG +++ + +  + ++VL   +  RVVR    G A+EF   Q     
Sbjct: 117 GSRMSCRIIDMSRSGAAIAAEQRPPLNAQVLLGRVASRVVRHLDDGFALEFVHEQLEETL 176

Query: 199 FKSL 202
             S+
Sbjct: 177 EDSV 180



 Score = 41.8 bits (97), Expect = 0.056,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 36/88 (40%), Gaps = 10/88 (11%)

Query: 3   RGIHNLQFIDQRAFQR-VKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGER 61
           R I NL   + R   R V  +      L DG+  +C + ++S  G  I  +    L  + 
Sbjct: 89  RDILNLP--EDRRHDRIVPRNPIAVLTLDDGSRMSCRIIDMSRSGAAIAAEQRPPLNAQV 146

Query: 62  SIVFVEKVGRIEGKVVNFDSNRGYAVRI 89
                  +GR+  +VV    + G+A+  
Sbjct: 147 L------LGRVASRVVRHLDD-GFALEF 167


>gi|110634076|ref|YP_674284.1| type IV pilus assembly PilZ [Mesorhizobium sp. BNC1]
 gi|110285060|gb|ABG63119.1| type IV pilus assembly PilZ [Chelativorans sp. BNC1]
          Length = 202

 Score =  250 bits (639), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 62/189 (32%), Positives = 108/189 (57%), Gaps = 4/189 (2%)

Query: 11  IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
            ++R FQRVK+ + GR++L D +E++C V ++SPG + +        VGER + +++ +G
Sbjct: 14  TERRRFQRVKISIYGRYMLPDRSEHSCRVVDMSPGSVALKAA-QAGQVGERIVAYLDHIG 72

Query: 71  RIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREV 130
           R+EG +     + G+ + I  S+ +R KLA +L WLAN+ DL L + R Y R    +   
Sbjct: 73  RVEGYLARIFED-GFEMTIKASQRKRDKLASQLTWLANRHDLDLPEDRRYERVTPANPM- 130

Query: 131 DAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFS 190
            + +   D  +H C+++D+S SG ++    +  + ++V   ++ GRV R F  G A+EFS
Sbjct: 131 -STIRTPDGYEHPCRIVDLSASGAAIETAPRPAIGTQVFLANLRGRVTRHFENGFALEFS 189

Query: 191 SVQESNIAF 199
            +QE     
Sbjct: 190 LIQEPATLL 198


>gi|222148624|ref|YP_002549581.1| hypothetical protein Avi_2200 [Agrobacterium vitis S4]
 gi|221735610|gb|ACM36573.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 203

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 70/190 (36%), Positives = 116/190 (61%), Gaps = 4/190 (2%)

Query: 13  QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRI 72
           QRAFQRV V L+GR ++    EY C+  ++SPG + ++C       GER I +++ +GRI
Sbjct: 18  QRAFQRVSVSLEGRLMVPSEDEYVCLTVDMSPGDVRVICAARPV-PGERIIAYIDHIGRI 76

Query: 73  EGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDA 132
           EG V+   ++ G+ + IV +E +R KLA +L W+ANK +L L + R + R   +    + 
Sbjct: 77  EGTVIK-TTDDGFVISIVATERKREKLAAQLTWIANKHELGLPEDRRHDRLTPKQPRTE- 134

Query: 133 QLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSV 192
            LV +D  K+SC+++D+S SG ++ +D++  + + V    + GRVVR F  G+AIEF+++
Sbjct: 135 -LVFDDGRKYSCRIMDLSLSGAAIDIDIRPPLGTAVRLGSMRGRVVRHFLEGVAIEFTTL 193

Query: 193 QESNIAFKSL 202
           Q      + L
Sbjct: 194 QSREALTEFL 203


>gi|190891887|ref|YP_001978429.1| hypothetical protein RHECIAT_CH0002296 [Rhizobium etli CIAT 652]
 gi|190697166|gb|ACE91251.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 203

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 68/191 (35%), Positives = 117/191 (61%), Gaps = 4/191 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           +Q  FQRV ++++GR +L +  E+ C+V ++SPG + + C        ER + +++ +GR
Sbjct: 17  EQGVFQRVPINMQGRLMLANYEEFECMVIDMSPGDMYVTCPGRP-RANERVVAYIDHLGR 75

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG V   D  RG+ + I  +E +R KLA +L WLANK +L L + R + R   RD + +
Sbjct: 76  VEGYVQTLD-GRGFTMSINATERKREKLAAQLTWLANKHELGLPEDRRHDRLTPRDIKTE 134

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
             L L+D T+++C+++D+S SG ++ V+++  + + V   ++ GRVVR F  G+AIEF S
Sbjct: 135 --LTLDDGTRYACRIMDLSLSGAAIDVEMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLS 192

Query: 192 VQESNIAFKSL 202
           +Q      + L
Sbjct: 193 IQSRETLREFL 203


>gi|241204776|ref|YP_002975872.1| type IV pilus assembly PilZ [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240858666|gb|ACS56333.1| type IV pilus assembly PilZ [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 203

 Score =  245 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 70/191 (36%), Positives = 116/191 (60%), Gaps = 4/191 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           +Q  FQRV ++++GR +L +  E+ C+V ++SPG + + C +      ER + +++ +GR
Sbjct: 17  EQGVFQRVPINMQGRLMLANYEEFECMVIDMSPGDMYVTC-LGRPRANERVVAYIDHLGR 75

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG V   D  RG+ + I  ++ +R KLA +L WLANK +L L + R + R   RD + D
Sbjct: 76  VEGYVQTID-GRGFTMSINATDRKREKLAAQLTWLANKHELGLPEDRRHDRLTPRDTKTD 134

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
             L L D T +SC+++D+S SG +V V+++  + + V   ++ GRVVR F  G+AIEF S
Sbjct: 135 --LTLEDGTLYSCRIMDLSLSGAAVDVEMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLS 192

Query: 192 VQESNIAFKSL 202
           +Q      + L
Sbjct: 193 IQSRETLREFL 203


>gi|209549449|ref|YP_002281366.1| type IV pilus assembly PilZ [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209535205|gb|ACI55140.1| type IV pilus assembly PilZ [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 203

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 69/191 (36%), Positives = 116/191 (60%), Gaps = 4/191 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           +Q  FQRV ++++GR +L    E+ C+V ++SPG + + C +      ER + +++ +GR
Sbjct: 17  EQGVFQRVPINMQGRLMLASYEEFECMVIDMSPGDMYVTC-LGRPRTNERVVAYIDHLGR 75

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG V   D  RG+ + I  +E +R KLA +L WLANK +L L + R + R   RD   +
Sbjct: 76  VEGYVQTLD-GRGFTMSINATERKREKLAAQLTWLANKHELGLPEDRRHDRLTPRD--TN 132

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
            +L L D T+++C+++D+S SG +V V+++  + + V   ++ GRVVR F  G+AIEF S
Sbjct: 133 TELTLEDGTRYTCRIMDLSLSGAAVDVEMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLS 192

Query: 192 VQESNIAFKSL 202
           +Q      + L
Sbjct: 193 IQSRETLREFL 203


>gi|315122695|ref|YP_004063184.1| hypothetical protein CKC_04735 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496097|gb|ADR52696.1| hypothetical protein CKC_04735 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 195

 Score =  245 bits (625), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 151/194 (77%), Positives = 174/194 (89%), Gaps = 2/194 (1%)

Query: 1   MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE 60
           MYRGIHNLQFIDQRAFQR+KVDLKGRFLLFDGTEY+C+VRE+SPGGLCI CDVP+ L+GE
Sbjct: 1   MYRGIHNLQFIDQRAFQRIKVDLKGRFLLFDGTEYDCVVREVSPGGLCIACDVPIVLIGE 60

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAY 120
           R IVFVEK+GRIEGKVVNFD  +GYAVRI++SE+ RRKLADKL+WLANKDDL LQD R Y
Sbjct: 61  RFIVFVEKIGRIEGKVVNFDIKKGYAVRIISSEDNRRKLADKLVWLANKDDLSLQDHRKY 120

Query: 121 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI 180
            RKI++D  V+AQL L + T HSC+VIDISESGVSVSVDL I++FSKV FNDILGRVVR 
Sbjct: 121 SRKISQD--VEAQLTLENKTVHSCQVIDISESGVSVSVDLHIKIFSKVFFNDILGRVVRN 178

Query: 181 FPGGIAIEFSSVQE 194
           FPGG+AIEF+++Q 
Sbjct: 179 FPGGVAIEFATIQN 192


>gi|116252283|ref|YP_768121.1| hypothetical protein RL2537 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256931|emb|CAK08025.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 203

 Score =  245 bits (625), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 69/191 (36%), Positives = 117/191 (61%), Gaps = 4/191 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           +Q  FQRV ++++GR +L +  E+ C+V ++SPG + + C +      ER + +++ +GR
Sbjct: 17  EQGVFQRVPINMQGRLMLANYEEFECMVIDMSPGDMYVTC-LGRPRANERVVAYIDHLGR 75

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG V   D  RG+ + I  ++ +R KLA +L WLANK +L L + R + R   RD + +
Sbjct: 76  VEGYVQTID-GRGFTMSINATDRKREKLAAQLTWLANKHELGLPEDRRHDRLTPRDTKTE 134

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
             L L D T++SC+++D+S SG +V V+++  + + V   ++ GRVVR F  G+AIEF S
Sbjct: 135 --LTLEDGTRYSCRIMDLSLSGAAVDVEMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLS 192

Query: 192 VQESNIAFKSL 202
           +Q      + L
Sbjct: 193 IQSRETLREFL 203


>gi|218462807|ref|ZP_03502898.1| hypothetical protein RetlK5_26662 [Rhizobium etli Kim 5]
          Length = 203

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 69/191 (36%), Positives = 116/191 (60%), Gaps = 4/191 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           +Q  FQRV ++++GR +L +  E+ C+V ++SPG + + C        ER + +++ +GR
Sbjct: 17  EQGVFQRVPINMQGRLMLANYEEFECMVIDMSPGDMYVTCSGRP-RANERVVAYIDHLGR 75

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG V      RG+ + I  +E +R KLA +L WLANK +L L + R + R   RD  V 
Sbjct: 76  VEGYV-QMLDGRGFTMSINATERKREKLAAQLTWLANKHELGLPEDRRHDRLTPRD--VK 132

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
            +L L+D T+++C+++D+S SG +V V+++  + + V   ++ GRVVR F  G+AIEF S
Sbjct: 133 TELTLDDGTRYACRIMDLSLSGAAVDVEMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLS 192

Query: 192 VQESNIAFKSL 202
           +Q      + L
Sbjct: 193 IQSRETLREFL 203


>gi|150396264|ref|YP_001326731.1| type IV pilus assembly PilZ [Sinorhizobium medicae WSM419]
 gi|150027779|gb|ABR59896.1| type IV pilus assembly PilZ [Sinorhizobium medicae WSM419]
          Length = 202

 Score =  243 bits (622), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 70/194 (36%), Positives = 111/194 (57%), Gaps = 4/194 (2%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEK 68
           +   + AFQRV V+L GR +L    EY C   E+SPG +           GER I +V+ 
Sbjct: 13  KAYQESAFQRVAVNLSGRLMLASHEEYACTAVEMSPGDVLFTSPARP-RGGERIIAYVDH 71

Query: 69  VGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDR 128
           VGR+EG V    S+  + +++  +E +R KLA +L W+ANK +L L + R + R   R  
Sbjct: 72  VGRLEGTVSRV-SDDAFVIQLNATERKREKLAAQLTWIANKHELGLPEDRRHDRLAPR-- 128

Query: 129 EVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIE 188
           +V  +L ++   ++SC++ID+S SG +V VD++  + + V   ++ GR+VR F  G+AIE
Sbjct: 129 KVLTELSVDSGERYSCRIIDLSLSGAAVDVDIRPAIGAPVKLGNMKGRIVRHFQEGVAIE 188

Query: 189 FSSVQESNIAFKSL 202
           FS +Q      + L
Sbjct: 189 FSGIQSREALTEFL 202


>gi|23009259|ref|ZP_00050375.1| hypothetical protein Magn03004185 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 208

 Score =  243 bits (622), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 66/203 (32%), Positives = 115/203 (56%), Gaps = 4/203 (1%)

Query: 1   MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE 60
           M      ++  DQR  QRV+  L GR++L D  EY C   ++SPGG+ + C V +  +GE
Sbjct: 9   MASPRLAIRAADQRRHQRVRTTLLGRYMLADRREYPCQTVDMSPGGVRLTCAV-LGELGE 67

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAY 120
           R +++++++GR+EG+VV     +G+A+RI  +  +R K+A +L+W+AN++ L L + R+ 
Sbjct: 68  RVVLYLDQIGRLEGEVVRHVP-QGFAMRINATPRKREKIASQLMWIANRESLGLPEGRSQ 126

Query: 121 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI 180
            R I     V   L L +      +++DIS SG +++   Q+ + + ++     GRVVR 
Sbjct: 127 ERLIPTQPGVT--LRLENGNVIPARIVDISMSGAALATRSQVPIGTHLMVGSTPGRVVRH 184

Query: 181 FPGGIAIEFSSVQESNIAFKSLI 203
           F GGI  +F      +   + +I
Sbjct: 185 FEGGIGAQFMLPISPDRFHEGII 207


>gi|15965167|ref|NP_385520.1| hypothetical protein SMc00999 [Sinorhizobium meliloti 1021]
 gi|307309181|ref|ZP_07588852.1| type IV pilus assembly PilZ [Sinorhizobium meliloti BL225C]
 gi|307321511|ref|ZP_07600906.1| type IV pilus assembly PilZ [Sinorhizobium meliloti AK83]
 gi|15074347|emb|CAC45993.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306892818|gb|EFN23609.1| type IV pilus assembly PilZ [Sinorhizobium meliloti AK83]
 gi|306900327|gb|EFN30943.1| type IV pilus assembly PilZ [Sinorhizobium meliloti BL225C]
          Length = 202

 Score =  243 bits (622), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 68/190 (35%), Positives = 109/190 (57%), Gaps = 4/190 (2%)

Query: 13  QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRI 72
           + AFQRV V+L GR +L    EY+C   E+SPG + +         GER I +V+ VGR+
Sbjct: 17  ESAFQRVSVNLSGRLMLASHEEYDCTALEMSPGDVLLTSPARP-RGGERIIAYVDHVGRL 75

Query: 73  EGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDA 132
           EG V     +  + +++  +E +R KLA +L W+ANK +L L + R + R   R  +   
Sbjct: 76  EGTVSRVADDA-FVIQLNATERKREKLAAQLTWIANKHELGLPEDRRHDRLAPR--KTLT 132

Query: 133 QLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSV 192
           +L ++   ++SC++ID+S SG +V +D +  + S V   ++ GR+VR F  G+AIEFS +
Sbjct: 133 ELTVDTGERYSCRIIDLSLSGAAVDIDTRPAVGSPVRLGNMKGRIVRHFQEGVAIEFSGI 192

Query: 193 QESNIAFKSL 202
           Q      + L
Sbjct: 193 QSREALTEFL 202



 Score = 34.8 bits (79), Expect = 7.3,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 32/87 (36%), Gaps = 8/87 (9%)

Query: 6   HNLQFIDQRAFQRV-KVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           H L   + R   R+          +  G  Y+C + ++S  G  +  D     VG     
Sbjct: 112 HELGLPEDRRHDRLAPRKTLTELTVDTGERYSCRIIDLSLSGAAVDIDTRPA-VGSPV-- 168

Query: 65  FVEKVGRIEGKVVNFDSNRGYAVRIVT 91
              ++G ++G++V      G A+    
Sbjct: 169 ---RLGNMKGRIVRHF-QEGVAIEFSG 191


>gi|220924974|ref|YP_002500276.1| type IV pilus assembly PilZ [Methylobacterium nodulans ORS 2060]
 gi|219949581|gb|ACL59973.1| type IV pilus assembly PilZ [Methylobacterium nodulans ORS 2060]
          Length = 209

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 70/200 (35%), Positives = 117/200 (58%), Gaps = 4/200 (2%)

Query: 4   GIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSI 63
           G+   +  D+R   RV + L GR++L D  EY C   +ISPGG+ +VC VP   +GER +
Sbjct: 13  GLLAARVADRRRHHRVAIALLGRYMLADRREYPCQTVDISPGGVRLVCAVP-GEIGERVV 71

Query: 64  VFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRK 123
           +++E +GR+EG +     + G+AV +  + ++R K+A +L WLAN+  L L + R + R 
Sbjct: 72  IYLEHLGRLEGTISRILPD-GFAVALSATPHKREKIASQLTWLANRASLGLPEDRRHERV 130

Query: 124 ITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPG 183
           + R   V   L L+D ++   ++ID+S SG +++ DL + + S +L      RVVR F G
Sbjct: 131 VPRQSAVT--LRLDDGSEVPARLIDVSLSGAALACDLPLPVDSPLLIGRTACRVVRQFKG 188

Query: 184 GIAIEFSSVQESNIAFKSLI 203
           G+A+EF      +   ++L+
Sbjct: 189 GLAVEFRLPLSPDRFDENLV 208


>gi|188581467|ref|YP_001924912.1| type IV pilus assembly PilZ [Methylobacterium populi BJ001]
 gi|179344965|gb|ACB80377.1| type IV pilus assembly PilZ [Methylobacterium populi BJ001]
          Length = 207

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 65/193 (33%), Positives = 108/193 (55%), Gaps = 4/193 (2%)

Query: 10  FIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKV 69
             +QR  QRV+  L GR++L D  EY C   ++SPGG+ + C V +  +GER ++++E++
Sbjct: 17  AAEQRRHQRVRATLLGRYMLADRREYPCQTVDMSPGGVRLTCAV-IGALGERVVLYLEQI 75

Query: 70  GRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDRE 129
           GR+EG +V      G+A+RI  +  +R K+A +L+WLAN++ L L + R   R +     
Sbjct: 76  GRLEGVIVRH-PPGGFAMRINATPRKRDKIASQLMWLANRESLGLPEGRTNERLVPNQPG 134

Query: 130 VDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
           V   L L +    + ++IDIS SGV+++      + + +L     GRVVR F GGI  +F
Sbjct: 135 VT--LRLENGRFIAARIIDISMSGVALATASAPPIGTHLLVGSTPGRVVRYFEGGIGAQF 192

Query: 190 SSVQESNIAFKSL 202
                 +   + +
Sbjct: 193 MLPISPDRFHEGI 205


>gi|153009265|ref|YP_001370480.1| type IV pilus assembly PilZ [Ochrobactrum anthropi ATCC 49188]
 gi|151561153|gb|ABS14651.1| type IV pilus assembly PilZ [Ochrobactrum anthropi ATCC 49188]
          Length = 201

 Score =  238 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 65/185 (35%), Positives = 109/185 (58%), Gaps = 4/185 (2%)

Query: 11  IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
           + Q  F  V VDL GR++L + +E+ CI++ +SPG   ++  +     GER I +++ VG
Sbjct: 13  VRQENFNAVNVDLNGRYMLENRSEFPCIIKRMSPGT-ALMSGIATPRNGERIIAYIDHVG 71

Query: 71  RIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREV 130
           RIEG + N  ++ G+ + + TSE ++ KL+ +L WLANK +L L + R + R + R  + 
Sbjct: 72  RIEG-IANEVTSEGFHILLSTSEQKKDKLSAQLTWLANKHELALPEDRRHERVVPR--KT 128

Query: 131 DAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFS 190
              +   D  +  C++ D+S SG ++  + +  + S V+   I G VVR F GG AIEF+
Sbjct: 129 QQNITFADGAQRLCRIADLSLSGAAIESEFKPAIKSGVMLGPIRGTVVRHFQGGFAIEFA 188

Query: 191 SVQES 195
           ++Q S
Sbjct: 189 TIQTS 193



 Score = 39.4 bits (91), Expect = 0.26,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 32/88 (36%), Gaps = 10/88 (11%)

Query: 6   HNLQFIDQRAFQR-VKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDV-PMFLVGERSI 63
           H L   + R  +R V    +      DG +  C + ++S  G  I  +  P    G    
Sbjct: 110 HELALPEDRRHERVVPRKTQQNITFADGAQRLCRIADLSLSGAAIESEFKPAIKSGVM-- 167

Query: 64  VFVEKVGRIEGKVVNFDSNRGYAVRIVT 91
                +G I G VV      G+A+   T
Sbjct: 168 -----LGPIRGTVVRHFQG-GFAIEFAT 189


>gi|170751021|ref|YP_001757281.1| type IV pilus assembly PilZ [Methylobacterium radiotolerans JCM
           2831]
 gi|170657543|gb|ACB26598.1| type IV pilus assembly PilZ [Methylobacterium radiotolerans JCM
           2831]
          Length = 213

 Score =  237 bits (604), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 65/194 (33%), Positives = 107/194 (55%), Gaps = 4/194 (2%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEK 68
              DQR  QRV+V + GR++L D  EY C   ++SPGG+ + C V    VGER ++++E 
Sbjct: 22  GAADQRRHQRVRVAVLGRYMLADRREYPCQTVDMSPGGVRLTCAVK-GEVGERVVLYLEH 80

Query: 69  VGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDR 128
           +GRIEG V     + G+AV++  +  +R KLA +L WLAN++ L L + R++ R +  + 
Sbjct: 81  IGRIEGVVARTCPD-GFAVQLNATSRKRDKLASQLTWLANREMLGLPEGRSHERLVPTN- 138

Query: 129 EVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIE 188
                L +    +   ++IDIS SGV++S  + + + + V      GR+VR F GG  ++
Sbjct: 139 -TAVVLRVEGGREIRARLIDISMSGVAISCPVPLPLGAAVTVGSTPGRLVRYFEGGFGVQ 197

Query: 189 FSSVQESNIAFKSL 202
           F      +     +
Sbjct: 198 FLLPLSPDRFHTGM 211



 Score = 54.9 bits (131), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 8/88 (9%)

Query: 106 LANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMF 165
           LA +      D R + R       V  + +L D  ++ C+ +D+S  GV ++  ++ E+ 
Sbjct: 15  LAAEPARGAADQRRHQRV---RVAVLGRYMLADRREYPCQTVDMSPGGVRLTCAVKGEVG 71

Query: 166 SKVL-----FNDILGRVVRIFPGGIAIE 188
            +V+        I G V R  P G A++
Sbjct: 72  ERVVLYLEHIGRIEGVVARTCPDGFAVQ 99


>gi|227821814|ref|YP_002825784.1| hypothetical protein NGR_c12500 [Sinorhizobium fredii NGR234]
 gi|227340813|gb|ACP25031.1| hypothetical protein NGR_c12500 [Sinorhizobium fredii NGR234]
          Length = 203

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 64/191 (33%), Positives = 109/191 (57%), Gaps = 5/191 (2%)

Query: 13  QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRI 72
           + AFQRV V+L GR +L +  EY C   ++SPG + +         GER I +++ VGR+
Sbjct: 17  ENAFQRVSVNLSGRLMLANRDEYECTAVDMSPGDV-LFSTAARPRAGERIIAYIDHVGRL 75

Query: 73  EGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDA 132
           EG V     +  + +++  ++ +R KLA +L W+ANK +L L + R + R   R  +   
Sbjct: 76  EGTVSRLAEDA-FVIQLNATDRKREKLAAQLTWIANKHELGLPEDRRHDRLAPR--KTVT 132

Query: 133 QLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFND-ILGRVVRIFPGGIAIEFSS 191
           +L ++   K+ C++ID+S SG +V +D++  + + V   + + GR+VR F  G+AIEFS 
Sbjct: 133 ELTVDTGEKYICRIIDLSLSGAAVDIDVRPAIGTAVRLGNGMKGRIVRHFQEGVAIEFSG 192

Query: 192 VQESNIAFKSL 202
           +Q      + L
Sbjct: 193 IQAREALTEFL 203


>gi|239832143|ref|ZP_04680472.1| type IV pilus assembly PilZ [Ochrobactrum intermedium LMG 3301]
 gi|239824410|gb|EEQ95978.1| type IV pilus assembly PilZ [Ochrobactrum intermedium LMG 3301]
          Length = 202

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 62/186 (33%), Positives = 108/186 (58%), Gaps = 4/186 (2%)

Query: 11  IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
           + Q  F  V VDL GR++L + +E+ C+++ +SPG   ++  +     GER I +++ VG
Sbjct: 14  VRQENFNAVNVDLNGRYMLENRSEFPCVIKRMSPGT-ALMSGIATPRNGERIIAYIDHVG 72

Query: 71  RIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREV 130
           RIEG + +  ++ G+ + + TSE ++ KL+ +L WLANK +L L + R + R +      
Sbjct: 73  RIEG-IAHEVTSEGFHILLATSEQKKDKLSAQLTWLANKHELALPEDRRHERVVPHKNRQ 131

Query: 131 DAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFS 190
           +  +   D T+  C++ D+S SG ++  + +  + S V+   I G VVR F  G AIEF+
Sbjct: 132 N--ITFADGTQRLCRIADLSLSGAAIESEFKPAIKSSVMLGPIRGTVVRHFQDGFAIEFA 189

Query: 191 SVQESN 196
           ++Q S 
Sbjct: 190 TIQTSA 195



 Score = 39.8 bits (92), Expect = 0.22,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 33/87 (37%), Gaps = 8/87 (9%)

Query: 6   HNLQFIDQRAFQR-VKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           H L   + R  +R V    +      DGT+  C + ++S  G  I  +    +       
Sbjct: 111 HELALPEDRRHERVVPHKNRQNITFADGTQRLCRIADLSLSGAAIESEFKPAIKSSVM-- 168

Query: 65  FVEKVGRIEGKVVNFDSNRGYAVRIVT 91
               +G I G VV    + G+A+   T
Sbjct: 169 ----LGPIRGTVVRHFQD-GFAIEFAT 190


>gi|218530487|ref|YP_002421303.1| type IV pilus assembly PilZ [Methylobacterium chloromethanicum CM4]
 gi|218522790|gb|ACK83375.1| type IV pilus assembly PilZ [Methylobacterium chloromethanicum CM4]
          Length = 207

 Score =  235 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 64/193 (33%), Positives = 107/193 (55%), Gaps = 4/193 (2%)

Query: 10  FIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKV 69
             +QR  QRV+  L GR++L D  EY C   ++SPGG+ + C V +  + ER ++++E++
Sbjct: 17  AAEQRRHQRVRATLLGRYMLADRREYPCQTVDMSPGGVRLTCAV-IGALNERVVLYLEQI 75

Query: 70  GRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDRE 129
           GR+EG +V     RG+A+RI  +  +R K+A +L+WLAN++ L L + R   R +     
Sbjct: 76  GRLEGVIVRH-PPRGFAMRINATPRKRDKIASQLMWLANRESLGLPEGRTNERLVPNQPG 134

Query: 130 VDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
           V   L L      + ++IDIS SGV+++      + + ++     GRVVR F GGI  +F
Sbjct: 135 VT--LRLESGRFIAARIIDISMSGVALATASSPPIGAHIMVGSTPGRVVRYFEGGIGAQF 192

Query: 190 SSVQESNIAFKSL 202
                 +   + +
Sbjct: 193 MLPISPDRFHEGI 205


>gi|240138848|ref|YP_002963323.1| hypothetical protein MexAM1_META1p2255 [Methylobacterium extorquens
           AM1]
 gi|254561451|ref|YP_003068546.1| hypothetical protein METDI3037 [Methylobacterium extorquens DM4]
 gi|240008820|gb|ACS40046.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
 gi|254268729|emb|CAX24690.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 199

 Score =  235 bits (600), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 65/193 (33%), Positives = 107/193 (55%), Gaps = 4/193 (2%)

Query: 10  FIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKV 69
             +QR  QRV+  L GR++L D  EY C   ++SPGG+ + C V +  + ER ++++E++
Sbjct: 9   AAEQRRHQRVRATLLGRYMLADRREYPCQTVDMSPGGVRLTCAV-IGALNERVVLYLEQI 67

Query: 70  GRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDRE 129
           GR+EG +V     RG+A+RI  +  +R K+A +L+WLAN++ L L + R   R +     
Sbjct: 68  GRLEGVIVRH-PPRGFAMRINATPRKRDKIASQLMWLANRESLGLPEGRTNERLVPNQPG 126

Query: 130 VDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
           V   L L      + ++IDIS SGV+++      + + +L     GRVVR F GGI  +F
Sbjct: 127 VT--LRLESGRFIAARIIDISMSGVALATASSPPIGAHILVGSTPGRVVRYFEGGIGAQF 184

Query: 190 SSVQESNIAFKSL 202
                 +   + +
Sbjct: 185 MLPISPDRFHEGI 197


>gi|163851681|ref|YP_001639724.1| type IV pilus assembly PilZ [Methylobacterium extorquens PA1]
 gi|163663286|gb|ABY30653.1| type IV pilus assembly PilZ [Methylobacterium extorquens PA1]
          Length = 207

 Score =  235 bits (600), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 65/193 (33%), Positives = 107/193 (55%), Gaps = 4/193 (2%)

Query: 10  FIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKV 69
             +QR  QRV+  L GR++L D  EY C   ++SPGG+ + C V +  + ER ++++E++
Sbjct: 17  AAEQRRHQRVRATLLGRYMLADRREYPCQTVDMSPGGVRLTCAV-IGALNERVVLYLEQI 75

Query: 70  GRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDRE 129
           GR+EG +V     RG+A+RI  +  +R K+A +L+WLAN++ L L + R   R +     
Sbjct: 76  GRLEGVIVRH-PPRGFAMRINATPRKRDKIASQLMWLANRESLGLPEGRTNERLVPNQPG 134

Query: 130 VDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
           V   L L      + ++IDIS SGV+++      + + +L     GRVVR F GGI  +F
Sbjct: 135 VT--LRLESGRFIAARIIDISMSGVALATASSPPIGAHILVGSTPGRVVRYFEGGIGAQF 192

Query: 190 SSVQESNIAFKSL 202
                 +   + +
Sbjct: 193 MLPISPDRFHEGI 205


>gi|323138251|ref|ZP_08073323.1| type IV pilus assembly PilZ [Methylocystis sp. ATCC 49242]
 gi|322396503|gb|EFX99032.1| type IV pilus assembly PilZ [Methylocystis sp. ATCC 49242]
          Length = 204

 Score =  230 bits (586), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 60/185 (32%), Positives = 95/185 (51%), Gaps = 4/185 (2%)

Query: 8   LQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVE 67
           L   + R FQRV V + GR++L    EY C   E+SPG + +   V    VGE+ +V+++
Sbjct: 12  LDANENRRFQRVPVKMFGRYMLESRREYPCQTVEMSPGDMTLFAPVK-AEVGEKVVVYLD 70

Query: 68  KVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRD 127
           ++GR  G  V   ++ G+A+ +     +R KLAD+L W AN+   +L + R + R +   
Sbjct: 71  EIGRFAGVAVRV-TDTGFAMAMNLPPMKRDKLADQLTWFANRHAFNLPEDRRHERIVPLM 129

Query: 128 REVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAI 187
           +     L + D  +   K+ DIS SGV V  D +  + +++L       VVR F  GI  
Sbjct: 130 QRT--LLRMPDGQELMAKIRDISLSGVGVETDARPPLGARILVGSTPALVVRHFDSGIGG 187

Query: 188 EFSSV 192
           EF   
Sbjct: 188 EFERP 192


>gi|170741419|ref|YP_001770074.1| type IV pilus assembly PilZ [Methylobacterium sp. 4-46]
 gi|168195693|gb|ACA17640.1| type IV pilus assembly PilZ [Methylobacterium sp. 4-46]
          Length = 209

 Score =  230 bits (586), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 72/199 (36%), Positives = 114/199 (57%), Gaps = 4/199 (2%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           +   Q  D+R   RV V L GR++L D  EY C   +ISPGG+ +VC V    VGER+++
Sbjct: 14  LLAAQASDRRRHHRVTVSLLGRYMLSDRREYPCQTVDISPGGVRLVCAV-TGEVGERTVI 72

Query: 65  FVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKI 124
           ++E +GRIEG +     + G+AV I  + ++R K+A +L WLAN+  L L + R + R +
Sbjct: 73  YLEHLGRIEGTIARVLPD-GFAVAISATAHKREKIASQLTWLANRASLGLPEDRRHERVV 131

Query: 125 TRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGG 184
            R  +    L L+   +   ++ID+S SG +++ DL + + S +L      RVVR F GG
Sbjct: 132 PR--QTAVTLRLDTGVEVPARLIDVSLSGAALACDLPLAIDSALLVGRTPCRVVRQFRGG 189

Query: 185 IAIEFSSVQESNIAFKSLI 203
           IA+EF      +   ++L+
Sbjct: 190 IAVEFRLPISPDRFDENLV 208


>gi|90417800|ref|ZP_01225712.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337472|gb|EAS51123.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 216

 Score =  227 bits (579), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 59/184 (32%), Positives = 103/184 (55%), Gaps = 4/184 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++ +F RV++DL GRF+  D TE+ C    +SPG + +   V      ER IV+++ +GR
Sbjct: 31  ERSSFMRVRIDLLGRFMREDRTEFPCRAENMSPGDVSVTASVVPVE-NERIIVYIDHIGR 89

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +EG V       G+ +   ++  +R KLA +L W AN+ +L L + R + R    +  VD
Sbjct: 90  LEGAVSRVFEG-GFDLAFQSTPRKREKLAAQLTWFANRHELSLPEDRRHERNAPENPFVD 148

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
             +VL+D  ++  ++ID+S SG +V+  ++  + S++      GR+VR    G A+EFS+
Sbjct: 149 --MVLDDGRRYPAQIIDLSLSGAAVTSSIRPAVGSRITLGTTTGRIVRHIEDGFAVEFSA 206

Query: 192 VQES 195
            +  
Sbjct: 207 ERAR 210


>gi|15889059|ref|NP_354740.1| hypothetical protein Atu8163 [Agrobacterium tumefaciens str. C58]
 gi|15156856|gb|AAK87525.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 205

 Score =  222 bits (565), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 62/201 (30%), Positives = 103/201 (51%), Gaps = 10/201 (4%)

Query: 3   RGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERS 62
           R +      D      V+V   GR +L D  EY+C   E++       C   M   G+R 
Sbjct: 14  RPVEEAHLDD-----AVRVSFTGRLMLPDHEEYDCTATEMTAERAQFTCSG-MARNGDRV 67

Query: 63  IVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGR 122
           I +++ +GRIEG V       G+ + I   E +R KLA +L W+A +  L L + R + R
Sbjct: 68  IAYLQHIGRIEGTVTALTP-AGFLIAINAPERKREKLAAQLAWIAKRQLLGLPEDRRHDR 126

Query: 123 KITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFN-DILGRVVRIF 181
              R+ +  AQLVL D    +C++ID+S SG ++ ++ +  + S+V    ++ G++VR F
Sbjct: 127 LTPRNAK--AQLVLEDGVLVACRLIDLSLSGAAIEIENRPPLGSRVQLGKNMSGKIVRHF 184

Query: 182 PGGIAIEFSSVQESNIAFKSL 202
             G+A+EF  VQ  +   + +
Sbjct: 185 MEGVAVEFDRVQSPDALIEFI 205


>gi|325293138|ref|YP_004279002.1| hypothetical protein AGROH133_06723 [Agrobacterium sp. H13-3]
 gi|325060991|gb|ADY64682.1| hypothetical protein AGROH133_06723 [Agrobacterium sp. H13-3]
          Length = 205

 Score =  222 bits (565), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 60/201 (29%), Positives = 105/201 (52%), Gaps = 10/201 (4%)

Query: 3   RGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERS 62
           R +  + F D      V+V   GR +L D  EY+C   E++       C   +   G+R 
Sbjct: 14  RPVEEVHFDDP-----VRVSFTGRLMLPDHQEYDCTATEMTAERALFACSG-IARNGDRV 67

Query: 63  IVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGR 122
           I +++ +GRIEG V    ++ G+ + I   E +R KLA +L W+A +  L L + R + R
Sbjct: 68  ISYLQHIGRIEGTVTALTAS-GFVIAINAPERKREKLAAQLAWIAKRQLLGLPEDRRHDR 126

Query: 123 KITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFN-DILGRVVRIF 181
              R+    A L+L D    +C++ID+S SG ++ ++ +  + ++V    ++ G++VR F
Sbjct: 127 LTPRN--TRAHLMLEDGVLLACRLIDLSLSGAAIEIENRPPLGTRVQLGKNMSGKIVRHF 184

Query: 182 PGGIAIEFSSVQESNIAFKSL 202
             G+A+EF  VQ  +   + L
Sbjct: 185 MEGVAVEFDRVQSPDALIEFL 205


>gi|163760300|ref|ZP_02167383.1| hypothetical protein HPDFL43_08559 [Hoeflea phototrophica DFL-43]
 gi|162282699|gb|EDQ32987.1| hypothetical protein HPDFL43_08559 [Hoeflea phototrophica DFL-43]
          Length = 171

 Score =  218 bits (556), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 53/170 (31%), Positives = 99/170 (58%), Gaps = 4/170 (2%)

Query: 28  LLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAV 87
           +  D +E++C+V  +SP    ++       VGER + +++ +GRIEG V      R + +
Sbjct: 1   MRADHSEHDCVVDTMSPFD-AVISSNAQPAVGERIVAYLDYLGRIEGAVTEA-GMRTFTM 58

Query: 88  RIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVI 147
            +  ++ +R KL+ +L WLANK +L L + R + R    +    +++ L D  ++ C++I
Sbjct: 59  SLNATDRKRDKLSAQLTWLANKHELGLPEDRNHERVAPSNP--SSEIQLEDGRRYPCRII 116

Query: 148 DISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNI 197
           D+S SG ++ +D++    + V+  ++ GRVVR F  GIA+EF++VQ  + 
Sbjct: 117 DLSVSGAAIEIDVRPAFGTMVILGNMRGRVVRHFQEGIAMEFTTVQPEDA 166


>gi|218681768|ref|ZP_03529535.1| type IV pilus assembly PilZ [Rhizobium etli CIAT 894]
          Length = 163

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 62/166 (37%), Positives = 100/166 (60%), Gaps = 4/166 (2%)

Query: 37  CIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENER 96
           C+V ++SPG + + C        ER + +++ +GR+EG V   D  RG+A+ I  +E +R
Sbjct: 2   CMVIDMSPGDMYVTCSGRP-RANERVVAYIDHLGRVEGYVQTLD-GRGFAMSINATERKR 59

Query: 97  RKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSV 156
            KLA +L WLANK +L L + R + R   RD   + +L L D T++SC+++D+S SG +V
Sbjct: 60  EKLAAQLTWLANKHELGLPEDRRHDRLTPRD--TNTELTLEDGTRYSCRIMDLSLSGAAV 117

Query: 157 SVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSL 202
            V+++  + + V   ++ GRVVR F  G+AIEF S+Q      + L
Sbjct: 118 DVEMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLSIQSRETLREFL 163



 Score = 34.4 bits (78), Expect = 9.5,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 38/95 (40%), Gaps = 9/95 (9%)

Query: 6   HNLQFIDQRAFQRV-KVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           H L   + R   R+   D      L DGT Y+C + ++S  G  +  ++    +G     
Sbjct: 73  HELGLPEDRRHDRLTPRDTNTELTLEDGTRYSCRIMDLSLSGAAVDVEMRP-SIGTAV-- 129

Query: 65  FVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKL 99
              ++G + G+VV      G A+    S   R  L
Sbjct: 130 ---RLGNMRGRVVRHFV-EGVAIEF-LSIQSRETL 159


>gi|114704737|ref|ZP_01437645.1| hypothetical protein FP2506_07371 [Fulvimarina pelagi HTCC2506]
 gi|114539522|gb|EAU42642.1| hypothetical protein FP2506_07371 [Fulvimarina pelagi HTCC2506]
          Length = 195

 Score =  215 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 61/185 (32%), Positives = 103/185 (55%), Gaps = 4/185 (2%)

Query: 16  FQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGK 75
           +  V VD+ GRF+  D +EY C + E+SPG + ++  V    + ER IV+ + VGR+EG+
Sbjct: 12  YSAVSVDILGRFMRSDTSEYPCRIEEMSPGAVQVIAPVAPD-IRERIIVYADHVGRLEGE 70

Query: 76  VVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLV 135
           V       G+ ++ + SE  R KLA KL WL N+  L+L + R + R    +   D  +V
Sbjct: 71  VAELFEG-GFCLKTLASERRREKLAAKLTWLTNRQLLNLPEDRRHERVQPENPFRD--IV 127

Query: 136 LNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQES 195
           L+D  ++  K+ID+S SG ++   ++  + + +    + GR++R    G A+EFSSV   
Sbjct: 128 LDDGRRYKVKIIDLSLSGAALQSKVRPVIGTSITLGAMPGRIIRYLEDGFAVEFSSVLNE 187

Query: 196 NIAFK 200
           +   +
Sbjct: 188 DSLHR 192


>gi|86357823|ref|YP_469715.1| hypothetical protein RHE_CH02207 [Rhizobium etli CFN 42]
 gi|86281925|gb|ABC90988.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 161

 Score =  210 bits (536), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 59/164 (35%), Positives = 98/164 (59%), Gaps = 4/164 (2%)

Query: 39  VREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRK 98
           V ++SPG + + C        ER + +++ +GR+EG V   DS RG+ + I  +E +R K
Sbjct: 2   VIDMSPGDMYVTCSGRP-RANERVVAYIDHLGRVEGYVQTLDS-RGFTMSINATERKREK 59

Query: 99  LADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSV 158
           LA +L WLANK +L L + R + R   RD + +  L L D T+++C+++D+S SG ++ V
Sbjct: 60  LAAQLTWLANKHELGLPEDRRHDRLTPRDTKTE--LTLEDGTRYTCRIMDLSLSGAAIDV 117

Query: 159 DLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSL 202
           +++  + + V   ++ GRVVR F  G+AIEF S+Q      + L
Sbjct: 118 EMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLSIQSRETLREFL 161



 Score = 34.4 bits (78), Expect = 9.0,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 38/95 (40%), Gaps = 9/95 (9%)

Query: 6   HNLQFIDQRAFQRV-KVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           H L   + R   R+   D K    L DGT Y C + ++S  G  I  ++    +G     
Sbjct: 71  HELGLPEDRRHDRLTPRDTKTELTLEDGTRYTCRIMDLSLSGAAIDVEMRP-SIGTAV-- 127

Query: 65  FVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKL 99
              ++G + G+VV      G A+    S   R  L
Sbjct: 128 ---RLGNMRGRVVRHFV-EGVAIEF-LSIQSRETL 157


>gi|327188331|gb|EGE55549.1| hypothetical protein RHECNPAF_910024 [Rhizobium etli CNPAF512]
          Length = 161

 Score =  210 bits (536), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 98/164 (59%), Gaps = 4/164 (2%)

Query: 39  VREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRK 98
           V ++SPG + + C        ER + +++ +GR+EG V   D  RG+ + I  +E +R K
Sbjct: 2   VIDMSPGDMYVTCPGRP-RANERVVAYIDHLGRVEGYVQTLD-GRGFTMSINATERKREK 59

Query: 99  LADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSV 158
           LA +L WLANK +L L + R + R   RD + +  L L+D T+++C+++D+S SG ++ V
Sbjct: 60  LAAQLTWLANKHELGLPEDRRHDRLTPRDIKTE--LTLDDGTRYACRIMDLSLSGAAIDV 117

Query: 159 DLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSL 202
           +++  + + V   ++ GRVVR F  G+AIEF S+Q      + L
Sbjct: 118 EMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLSIQSRETLREFL 161


>gi|323136579|ref|ZP_08071660.1| type IV pilus assembly PilZ [Methylocystis sp. ATCC 49242]
 gi|322397896|gb|EFY00417.1| type IV pilus assembly PilZ [Methylocystis sp. ATCC 49242]
          Length = 201

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 59/181 (32%), Positives = 99/181 (54%), Gaps = 4/181 (2%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEK 68
               +R    V+VDL+GRF+L  G E+ C +  +S G +     V    +GE+ IV++ +
Sbjct: 10  GAARERIHNSVEVDLEGRFMLASGAEHPCRIVAMSTGEMLFSTPVRP-RLGEKVIVYIAE 68

Query: 69  VGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDR 128
           +GR EG V       G+A+ +  +E + RKLA++L+W AN+D L L + R + R +   +
Sbjct: 69  LGRFEGGVSRH-EGEGFAIGLKLTEMKHRKLAEQLVWFANRDVLDLPENRRHKRIVPMLQ 127

Query: 129 EVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIE 188
                + L++  + + K+ DIS SGVSV V+ +  +  +V+      +VVR+  GG   E
Sbjct: 128 WTI--VRLSNGKEKTAKINDISLSGVSVEVNARPLVGGRVMVGSKAAKVVRLVDGGFVAE 185

Query: 189 F 189
           F
Sbjct: 186 F 186


>gi|154253084|ref|YP_001413908.1| type IV pilus assembly PilZ [Parvibaculum lavamentivorans DS-1]
 gi|154157034|gb|ABS64251.1| type IV pilus assembly PilZ [Parvibaculum lavamentivorans DS-1]
          Length = 205

 Score =  197 bits (502), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 61/190 (32%), Positives = 105/190 (55%), Gaps = 4/190 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R + RV V+  GRFL  DG+E+ C +R+IS GG+ I   VP+  +G + IV+++  GR
Sbjct: 13  ERRRYPRVAVETPGRFLAPDGSEHQCALRDISIGGIAISSPVPL-QIGAQIIVYIDDFGR 71

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKIT--RDRE 129
            EGK+V      G+A+    S   R +L  +L  LA  + + +   RA+ R +      E
Sbjct: 72  FEGKIVRVFDG-GFAIETAISGPRRERLQQRLEALARGEKIDVSARRAFARYVPGEAGLE 130

Query: 130 VDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
             + L + D +   C++ID+S  G  V++D +  + ++V    + GR+VR    G+ I+F
Sbjct: 131 ESSVLTMTDGSSIPCRIIDMSLGGAQVAIDPRPMIGTQVSIGKMQGRIVRHTEEGVGIQF 190

Query: 190 SSVQESNIAF 199
           ++V E + A 
Sbjct: 191 TNVPEHSNAL 200


>gi|192290093|ref|YP_001990698.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris TIE-1]
 gi|192283842|gb|ACF00223.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris TIE-1]
          Length = 243

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 56/197 (28%), Positives = 100/197 (50%), Gaps = 17/197 (8%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTE-------YNCIVREISPGGLCIVCDVP-MFLVGE 60
           +F+ QRA   V V + G + L +  +       + C    +SP    ++ DVP +  VG+
Sbjct: 5   RFLKQRA---VNVTVGGNYSLANWYDQNGKLRQFACRTSRVSP--FRMIVDVPVIGRVGD 59

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKD-DLHLQDCRA 119
               +  + G+++G + +     G+ + +  +   R +L+++L WL  K  D  ++D R 
Sbjct: 60  HISSYFSEFGKLDGHISDTLPG-GFLLELAVTRAMRERLSNQLSWLEKKMLDPAIKDARE 118

Query: 120 YGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVR 179
             R +       + L L D + H+C VID+S SG +VS DLQ E+ + +     +GRVVR
Sbjct: 119 QARVVPVCPH--SSLTLADGSSHTCFVIDMSISGAAVSADLQPEIGTPLAVGSCVGRVVR 176

Query: 180 IFPGGIAIEFSSVQESN 196
             P G A++F+ +Q  +
Sbjct: 177 HRPDGFAVKFTELQSRS 193


>gi|39934580|ref|NP_946856.1| hypothetical protein RPA1508 [Rhodopseudomonas palustris CGA009]
 gi|39648429|emb|CAE26950.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 243

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 56/197 (28%), Positives = 100/197 (50%), Gaps = 17/197 (8%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDG-------TEYNCIVREISPGGLCIVCDVP-MFLVGE 60
           +F+ QRA   V V + G + L +         ++ C    +SP    ++ DVP +  VG+
Sbjct: 5   RFLKQRA---VNVTVGGNYSLANWYNQNGKLRQFACRTSRVSP--FRMIVDVPVIGRVGD 59

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKD-DLHLQDCRA 119
               +  + G+++G + +     G+ + +  +   R +L+++L WL  K  D  ++D R 
Sbjct: 60  HISSYFSEFGKLDGHISDTLPG-GFLLELAVTRAMRERLSNQLSWLEKKMLDPAIKDARE 118

Query: 120 YGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVR 179
             R +       + L L D + H+C VID+S SG +VS DLQ E+ + +     +GRVVR
Sbjct: 119 QARVVPVCPH--SSLTLADGSSHTCFVIDMSISGAAVSADLQPEIGTPLAVGSCVGRVVR 176

Query: 180 IFPGGIAIEFSSVQESN 196
             P G A++F+ +Q  +
Sbjct: 177 HRPDGFAVKFTELQNRS 193


>gi|316935320|ref|YP_004110302.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris DX-1]
 gi|315603034|gb|ADU45569.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris DX-1]
          Length = 243

 Score =  195 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 58/197 (29%), Positives = 103/197 (52%), Gaps = 17/197 (8%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTE-------YNCIVREISPGGLCIVCDVP-MFLVGE 60
           +F+ QRA   V V + G + L +  +       + C    +SP    ++ DVP +  VG+
Sbjct: 5   RFLKQRA---VNVTVGGNYSLANWYDQNGKLRQFACRTSRVSP--FRMIVDVPVIGRVGD 59

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKD-DLHLQDCRA 119
           +   +  + G++EG + +     G+ + +  +   R +L+++L WL  K  D  ++D R 
Sbjct: 60  QISSYFSEFGKLEGHISDTLPG-GFLLELAVTRAMRERLSNQLSWLERKMLDPEIKDARE 118

Query: 120 YGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVR 179
             R +       + L+L D + H+C VID+S SGV+VS D+Q E+ + +     +GRVVR
Sbjct: 119 QARIVPACPH--STLILADGSTHTCFVIDMSISGVAVSADVQPEIGTPLAVGGCVGRVVR 176

Query: 180 IFPGGIAIEFSSVQESN 196
             P G A++F+ +Q  N
Sbjct: 177 HRPDGFAVKFTELQNRN 193


>gi|146342076|ref|YP_001207124.1| hypothetical protein BRADO5217 [Bradyrhizobium sp. ORS278]
 gi|146194882|emb|CAL78907.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 231

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 56/190 (29%), Positives = 94/190 (49%), Gaps = 15/190 (7%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTE-------YNCIVREISPGGLCIVCDVPMFLVGER 61
           +F+ QRA   V++   G + L +  +       + C    +SP    +   V +  VG+R
Sbjct: 6   RFLKQRA---VRIQTAGTYTLPNWYDPEGKLRSFACRTTRVSPFRALLDVPV-VGKVGDR 61

Query: 62  SIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKD-DLHLQDCRAY 120
              +    G+ EG++ +   + G+ + +  +  ER KLA+KL+WL  K  D  ++D R  
Sbjct: 62  LTSYFRDFGKFEGEISDTV-HGGFLLELEMTRAERAKLAEKLVWLEKKQKDPTVRDSRRE 120

Query: 121 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI 180
            R +       + L L D +   C VID S SG +VS ++Q E+ + +     +GRVVR 
Sbjct: 121 ARFVPNSPH--SALTLADGSIIPCFVIDASMSGAAVSAEVQPEIGTPLAVGSCVGRVVRH 178

Query: 181 FPGGIAIEFS 190
           FP G A++F 
Sbjct: 179 FPDGFAVKFV 188


>gi|300023305|ref|YP_003755916.1| type IV pilus assembly PilZ [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525126|gb|ADJ23595.1| type IV pilus assembly PilZ [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 208

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 58/200 (29%), Positives = 93/200 (46%), Gaps = 5/200 (2%)

Query: 3   RGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERS 62
           R        D R  +R+ + L GRF+  D  E+NC +  IS GG  +V       VGER 
Sbjct: 13  RPQDAAVARDMRRHRRLPLSLAGRFMRADRNEFNCQLENISVGGAAVVSPHAP-EVGERV 71

Query: 63  IVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGR 122
           I + + +G +EG V     + G+A     +E++R KLA +++WL N+ D   +  R + R
Sbjct: 72  IAYFDHLGGVEGVVARHTPD-GFAFSFKVTEHKREKLAAQIMWLINRSDFPEEAGRLHER 130

Query: 123 KITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFP 182
             TR R     L + D      +++D+S SG S+    +  + S V+       V R   
Sbjct: 131 VGTRGRRTT--LRVED-VIIDVELLDLSASGASLGTPARPPLGSFVVAGKTRAIVRRHHA 187

Query: 183 GGIAIEFSSVQESNIAFKSL 202
            GI ++F ++Q       S 
Sbjct: 188 QGIGVQFLTLQSPEALRDSF 207


>gi|90423310|ref|YP_531680.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisB18]
 gi|90105324|gb|ABD87361.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisB18]
          Length = 235

 Score =  191 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 55/203 (27%), Positives = 97/203 (47%), Gaps = 15/203 (7%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTE-------YNCIVREISPGGLCIVCDVPMFLVGER 61
           +F+ QRA   V + + G + L +  +       + C    +SP  + +   V +  +G+ 
Sbjct: 5   KFLKQRA---VNLVVGGHYTLANWYDMQGKPRNFACRTSRVSPFRMIMAVPV-VGRIGDH 60

Query: 62  SIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKD-DLHLQDCRAY 120
              +  + GR+EG++ +     G+ + +      RRKLAD+L WL  +  D  ++D R  
Sbjct: 61  ITSYFSEFGRLEGRISDTMPG-GFLLELAMPHALRRKLADQLAWLEARQRDPSVRDARRQ 119

Query: 121 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI 180
            R I       + L   D + H C VID+S SGV++S D+Q E+ + +     +GRVVR 
Sbjct: 120 ARIIPATPH--STLTFADGSIHGCFVIDMSVSGVAISADVQPEVGTPLAVGACVGRVVRH 177

Query: 181 FPGGIAIEFSSVQESNIAFKSLI 203
             GG A++F      +     ++
Sbjct: 178 LNGGFAVKFVEQVNRDDLESRIV 200


>gi|86751123|ref|YP_487619.1| hypothetical protein RPB_4015 [Rhodopseudomonas palustris HaA2]
 gi|86574151|gb|ABD08708.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 243

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 54/196 (27%), Positives = 99/196 (50%), Gaps = 17/196 (8%)

Query: 10  FIDQRAFQRVKVDLKGRFLLFDGTE-------YNCIVREISPGGLCIVCDVPM-FLVGER 61
           F+ QRA   V + + G + L +  +       + C    +SP    ++ DVP+   VG+ 
Sbjct: 6   FLKQRA---VNIAVGGNYSLANWYDQNGKPRNFACRTSRVSP--FRMIVDVPVVGRVGDA 60

Query: 62  SIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANK-DDLHLQDCRAY 120
              +    G+++G + +     G+ + +  +   R +L+++L WL  K +D  + D R  
Sbjct: 61  ISSYFSDFGKLDGHISDTVPG-GFLLELAVTRAMRERLSNQLNWLEKKLNDPAIVDAREQ 119

Query: 121 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI 180
            R +       + L++ D + H+C VID+S SGV+VS D+Q E+ + +     +GRVVR 
Sbjct: 120 ARIVPACPH--SSLIMADGSVHTCFVIDMSISGVAVSADVQPEIGTPLAVGGCVGRVVRH 177

Query: 181 FPGGIAIEFSSVQESN 196
              G A++FS +Q  +
Sbjct: 178 RSDGFAVKFSELQNRS 193


>gi|27379505|ref|NP_771034.1| hypothetical protein bll4394 [Bradyrhizobium japonicum USDA 110]
 gi|27352657|dbj|BAC49659.1| bll4394 [Bradyrhizobium japonicum USDA 110]
          Length = 221

 Score =  187 bits (476), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 49/203 (24%), Positives = 96/203 (47%), Gaps = 17/203 (8%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTE-------YNCIVREISPGGLCIVCDVPM-FLVGE 60
           +F+ QRA   V+V + G + L    +       + C  + +SP    ++ DVP+   +GE
Sbjct: 18  EFLRQRA---VEVTVSGSYSLPRWYDCEGKLRTFACRTKRVSP--FRMIVDVPVVGKIGE 72

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKD-DLHLQDCRA 119
           R   + +  G  +  +       G+ + +  +   R  +++KL WL  K  D  +Q+ R 
Sbjct: 73  RVTSYFQDFGEFQCTISATL-KSGFLMELDMTRARRAWMSEKLTWLEKKQRDASVQELRN 131

Query: 120 YGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVR 179
             R + +       L L D + H C +ID+S +GV++S +    + + +     +GRV+R
Sbjct: 132 DARFVPQVSHTF--LTLADGSTHPCFIIDVSTAGVAISCEYDPPIGTPLAIGACVGRVIR 189

Query: 180 IFPGGIAIEFSSVQESNIAFKSL 202
            F  G A++F+  Q+ +   + +
Sbjct: 190 KFDNGFAVKFAEKQQWDDVVRLI 212


>gi|148256955|ref|YP_001241540.1| hypothetical protein BBta_5681 [Bradyrhizobium sp. BTAi1]
 gi|146409128|gb|ABQ37634.1| hypothetical protein BBta_5681 [Bradyrhizobium sp. BTAi1]
          Length = 229

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 55/192 (28%), Positives = 95/192 (49%), Gaps = 15/192 (7%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTE-------YNCIVREISPGGLCIVCDVPMFLVGER 61
           +F+ QRA   V++   G + L +  +       + C    +SP    +   V +  +G+R
Sbjct: 5   RFLKQRA---VRIQTVGSYTLPNWYDPEGKLRSFACRTTRVSPFRALLDVPV-VGKIGDR 60

Query: 62  SIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKD-DLHLQDCRAY 120
              +  + G+ EG++ +   + G+ + +  +  ER KLA+KL+WL  +  D  ++D R  
Sbjct: 61  LTSYFREFGKFEGQISDTV-HGGFLLELEMTRAERAKLAEKLVWLEKRQRDPTIRDARRD 119

Query: 121 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI 180
            R +       + L+L D +   C VID S SGV+VS +LQ E+ + +     +GRVVR 
Sbjct: 120 ARYVPDSPH--SALMLADGSSIPCLVIDASMSGVAVSSELQPEIGTPLAVGSCVGRVVRH 177

Query: 181 FPGGIAIEFSSV 192
           F  G A+ F   
Sbjct: 178 FHDGFAVRFVDP 189


>gi|115523913|ref|YP_780824.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisA53]
 gi|115517860|gb|ABJ05844.1| type IV pilus assembly PilZ [Rhodopseudomonas palustris BisA53]
          Length = 240

 Score =  183 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 55/204 (26%), Positives = 97/204 (47%), Gaps = 17/204 (8%)

Query: 9   QFIDQRAFQRVKVDLKGRFLLFDGTE-------YNCIVREISPGGLCIVCDVPM-FLVGE 60
           +F  QRA   V + + G + L +  +       + C  R ISP    ++ DVP+   +G+
Sbjct: 6   KFFKQRA---VNIVVGGHYTLANWYDAHGKPRSFACRTRRISP--FRMMVDVPVVGRLGD 60

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANK-DDLHLQDCRA 119
               +    G++EG++ +  +   + + +  +   RR++AD+L WL  K  D  ++D R 
Sbjct: 61  SITSYFGDFGQLEGRITDTVAG-SFLLELDMTGEMRRRMADQLSWLEKKLKDPSVRDERK 119

Query: 120 YGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVR 179
           + R +       + L   D    SC VID+S SG ++S D+Q E+ + +     +GRVVR
Sbjct: 120 HARIVPATPH--STLTFGDGATRSCFVIDMSVSGAAISADVQPEIGTPLAVGAAVGRVVR 177

Query: 180 IFPGGIAIEFSSVQESNIAFKSLI 203
               G A+ F   Q      + +I
Sbjct: 178 HRQDGFAVSFVEPQRLEELERRII 201


>gi|323135566|ref|ZP_08070649.1| type IV pilus assembly PilZ [Methylocystis sp. ATCC 49242]
 gi|322398657|gb|EFY01176.1| type IV pilus assembly PilZ [Methylocystis sp. ATCC 49242]
          Length = 173

 Score =  180 bits (458), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 45/164 (27%), Positives = 79/164 (48%), Gaps = 4/164 (2%)

Query: 28  LLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAV 87
           +L    EY C   EISPG   +   V   + GE+ ++++  +GR  G      +  G+ +
Sbjct: 1   MLKSSEEYPCHTFEISPGEASLFAPVK-AMPGEKVVLYLRDLGRFAGLATRA-TEIGFEM 58

Query: 88  RIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVI 147
            +  S  +R +LAD+L W AN+  L + + R + R +         L L    +H  ++ 
Sbjct: 59  SLQLSPKKRERLADQLTWYANRSALAVDERRRHERIVPLMELTV--LRLARGDEHIVRIR 116

Query: 148 DISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
            +S SGV++  +L   +  +V+  +    VVR F  G+A EF +
Sbjct: 117 SLSLSGVALETELTPLLGEQVVIGNTPATVVRFFDDGLACEFVT 160


>gi|304391876|ref|ZP_07373818.1| type IV pilus assembly PilZ [Ahrensia sp. R2A130]
 gi|303296105|gb|EFL90463.1| type IV pilus assembly PilZ [Ahrensia sp. R2A130]
          Length = 209

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 52/192 (27%), Positives = 99/192 (51%), Gaps = 5/192 (2%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           D RA +R +++L GR LL +G E  C   +I    + I   +    +G+  IV+++++GR
Sbjct: 23  DDRAVERFRLELSGRCLLPNGLELPCQTTDIQHNAVSITA-LDSAELGQTIIVYLDELGR 81

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           + G+V       G+ + +  +E +R KLA+ +   A++D   +    + G       E +
Sbjct: 82  LSGEVTRIFEG-GFVLALELTERKRDKLAEHIESYADRDL--IDQVLSDGPSTPNINERN 138

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSS 191
            +LVL D   +  ++ D+S SG S++ ++   + ++V    + GRVV+ +PGG+ +EF  
Sbjct: 139 ERLVLTDGRSYPVQIKDLSLSGASMTCEVIPALSAQVEVAGLSGRVVQHYPGGLRVEFDR 198

Query: 192 VQESNIAFKSLI 203
                 +   LI
Sbjct: 199 A-HPAPSLSELI 209


>gi|254293022|ref|YP_003059045.1| type IV pilus assembly PilZ [Hirschia baltica ATCC 49814]
 gi|254041553|gb|ACT58348.1| type IV pilus assembly PilZ [Hirschia baltica ATCC 49814]
          Length = 193

 Score =  178 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 54/186 (29%), Positives = 88/186 (47%), Gaps = 6/186 (3%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           + N+   D+R F+RV  +   R L  DG E+N    ++  GG+ +  D P   +G++ I+
Sbjct: 11  VRNIGAKDRRRFRRVIHETTARCLWKDGHEFNAKTVDLCGGGVSLRTDEPC-NLGDQIII 69

Query: 65  FVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKI 124
           +V+++GR+ G      +  G+AV +     +  K  D+L W+ N+  L L+D R   R  
Sbjct: 70  YVDQLGRLAGTAAR-KTEEGFAVSVKFVPQKLDKFVDQLTWIVNQRSLGLEDDRLSRR-- 126

Query: 125 TRDREVDAQLVLNDNTKHSCKVIDISESGVSV-SVDLQIEMFSKVLFNDILGRVVRIFPG 183
            R                 C VIDIS  GV++ +   + E+ S+V      GR  R    
Sbjct: 127 -RTSSGQLIATYESGIVAQCNVIDISLLGVALRTSGPRPEIGSRVQIGRKAGRCARYVEN 185

Query: 184 GIAIEF 189
           G A+EF
Sbjct: 186 GFAVEF 191


>gi|114799843|ref|YP_761349.1| hypothetical protein HNE_2667 [Hyphomonas neptunium ATCC 15444]
 gi|114740017|gb|ABI78142.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 203

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 57/186 (30%), Positives = 96/186 (51%), Gaps = 6/186 (3%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           D+R F+R+++ L GRFL+ D  ++     +IS  G  IV      L  ++ + + ++VGR
Sbjct: 20  DRRGFKRIELKLAGRFLIGDSEDHVLSTADISCDGAFIVSSERPGL-DQQVVCYFDEVGR 78

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +   VV   S  G+AVR  TS ++R KLAD+L WL N+D L L++ R   R        +
Sbjct: 79  VVANVVRV-SPEGFAVRFHTSPHKRDKLADRLTWLLNRDKLGLEEERGEARYQASG---E 134

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQ-IEMFSKVLFNDILGRVVRIFPGGIAIEFS 190
           A + L++     C V DIS +G +     +   +  +V   +++G VVR+     A+ + 
Sbjct: 135 ATVNLSNGGHIQCSVTDISLTGAAFETGGKAPFVGERVTVGNLVGEVVRVAGNKFAVRYI 194

Query: 191 SVQESN 196
             Q+  
Sbjct: 195 HGQKPA 200



 Score = 41.8 bits (97), Expect = 0.058,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 6/81 (7%)

Query: 8   LQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVE 67
           L   ++R   R +   +    L +G    C V +IS  G           VGER  V   
Sbjct: 118 LGLEEERGEARYQASGEATVNLSNGGHIQCSVTDISLTGAAFETGGKAPFVGERVTV--- 174

Query: 68  KVGRIEGKVVNFDSNRGYAVR 88
             G + G+VV    N+ +AVR
Sbjct: 175 --GNLVGEVVRVAGNK-FAVR 192


>gi|114569626|ref|YP_756306.1| type IV pilus assembly PilZ [Maricaulis maris MCS10]
 gi|114340088|gb|ABI65368.1| type IV pilus assembly PilZ [Maricaulis maris MCS10]
          Length = 207

 Score =  174 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 57/197 (28%), Positives = 95/197 (48%), Gaps = 5/197 (2%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           I      ++R   RV + L GRF      E+ C + +ISPGG  I+  + +     R ++
Sbjct: 15  IAARGAQERRRHARVPLQLHGRFWSEANGEHACRLVDISPGGARIIARLNLAAE-TRIVL 73

Query: 65  FVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKI 124
            +  +GRIEG+VV   S    ++R      +R KLAD + W  NKD L L++ R   RK 
Sbjct: 74  MITSIGRIEGQVVR-QSGEEISIRFNAPLRKRDKLADAITWRFNKDRLGLEEDRTAPRKP 132

Query: 125 TRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGG 184
            R R   A+++L+D       V+D+S +G +     +  +   +   ++ GRV RI   G
Sbjct: 133 GRGR---ARILLSDGVVIQANVVDVSVTGAAFECLERPRVGEGLRVGEMSGRVARILDNG 189

Query: 185 IAIEFSSVQESNIAFKS 201
            A+ F   + +    ++
Sbjct: 190 FAVVFDPPEATAAGHEA 206


>gi|83945654|ref|ZP_00958000.1| hypothetical protein OA2633_15190 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851020|gb|EAP88879.1| hypothetical protein OA2633_15190 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 204

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 54/176 (30%), Positives = 84/176 (47%), Gaps = 5/176 (2%)

Query: 21  VDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFD 80
           + + GR L     E+ C + +ISPGG  I C  P     ER ++  + +GR+EG+V+   
Sbjct: 34  LTVPGRGLSPSAGEFTCTLVDISPGGARIACKTPPEKA-ERVVLLFDGLGRLEGEVLRA- 91

Query: 81  SNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNT 140
              G+ VR+  S+ +R +LAD + W  N   L L + R   RK  R R   A++ L D  
Sbjct: 92  GRSGFIVRLHGSQRKRDRLADAITWRFNMQRLGLDEDRTAPRKPGRGR---AKIRLRDGV 148

Query: 141 KHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESN 196
                VID+S SG + +   +  +   V   D+ G V R    G A+ F    + +
Sbjct: 149 VIQADVIDVSISGAAFACLERPRIGEAVRVGDMQGHVARWLDNGFAVAFDPPADRS 204


>gi|304319827|ref|YP_003853470.1| hypothetical protein PB2503_01247 [Parvularcula bermudensis
           HTCC2503]
 gi|303298730|gb|ADM08329.1| hypothetical protein PB2503_01247 [Parvularcula bermudensis
           HTCC2503]
          Length = 194

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 49/189 (25%), Positives = 87/189 (46%), Gaps = 9/189 (4%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           D+R+ +R+ +    RFLL +  E   +V  +S  GL +        +G   IV+V+ +GR
Sbjct: 8   DRRSHRRLPLRSAARFLLPEYGESQALVTNVSLSGLALKSPSRP-RLGVPLIVYVDALGR 66

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +E +VV   S+ G+A+    ++ + R++A K++  A      L   R  G          
Sbjct: 67  LEAEVVRHLSD-GFALVFKFTKEKTRRIARKILAFA------LNQRRGSGLASPTLARAT 119

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLF-NDILGRVVRIFPGGIAIEFS 190
           + +   D  + +CK+ D S  G  V  + +  + + V+    +   VVR    G A+EFS
Sbjct: 120 SPIRYEDGREEACKLRDFSILGAIVESERRPFLGATVIVHGRLEATVVRHLNDGYAVEFS 179

Query: 191 SVQESNIAF 199
              +S   F
Sbjct: 180 QYWQSIPKF 188



 Score = 58.7 bits (141), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 14/80 (17%), Positives = 32/80 (40%), Gaps = 7/80 (8%)

Query: 115 QDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLF---- 170
            + R   R++       A+ +L +  +    V ++S SG+++    +  +   ++     
Sbjct: 6   PEDRRSHRRLPL--RSAARFLLPEYGESQALVTNVSLSGLALKSPSRPRLGVPLIVYVDA 63

Query: 171 -NDILGRVVRIFPGGIAIEF 189
              +   VVR    G A+ F
Sbjct: 64  LGRLEAEVVRHLSDGFALVF 83


>gi|170742548|ref|YP_001771203.1| type IV pilus assembly PilZ [Methylobacterium sp. 4-46]
 gi|168196822|gb|ACA18769.1| type IV pilus assembly PilZ [Methylobacterium sp. 4-46]
          Length = 201

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 50/178 (28%), Positives = 88/178 (49%), Gaps = 5/178 (2%)

Query: 19  VKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVN 78
           V + + GR+LL +G E+ C  R +SP    ++  VP  L+G+   ++++ +G I G V+ 
Sbjct: 21  VLLRIAGRYLLPNGDEHACETRSLSPAEADLLAAVP-GLLGDPVTIYLDTIGAITG-VIR 78

Query: 79  FDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLND 138
             +  G+ V I  S   R ++A +L WLA + +  + D R+  R +   + V+  + L D
Sbjct: 79  SLTPTGFVVAIEVSPERRARIAARLDWLAARANGRI-DQRSDARIVPVTKAVE--VKLPD 135

Query: 139 NTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESN 196
                  +ID+S SG +V++  +  + + V        VVR   GGIA+ F       
Sbjct: 136 GALLPGTLIDLSMSGAAVAMAARPAVGATVTVGKRFATVVRHLDGGIAVAFKLPFRPE 193


>gi|218528286|ref|YP_002419102.1| type IV pilus assembly PilZ [Methylobacterium chloromethanicum CM4]
 gi|218520589|gb|ACK81174.1| type IV pilus assembly PilZ [Methylobacterium chloromethanicum CM4]
          Length = 185

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 47/178 (26%), Positives = 77/178 (43%), Gaps = 4/178 (2%)

Query: 19  VKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVN 78
           + V L GR LL  G E +C+ R      + +V       VG R I  V+ +G IE  V  
Sbjct: 4   IPVALAGRILLPCGAERDCLCRLSQADEVYVVIGDAGAAVGSRVICHVDGLGVIEASVTT 63

Query: 79  FDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLND 138
             S     + +  S   R +LA +L W   + D   +D R   R I  D  V+  + L+D
Sbjct: 64  V-SRGSLRLSVEGSPAHRARLATRLAWHRARLD-GREDQRGAMRVIPLDPSVE--VTLSD 119

Query: 139 NTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESN 196
                 +++D+S +G ++ + L+  + + +       RVVR    G+A+ F       
Sbjct: 120 GMAVEARIVDLSATGAALEMVLRPPLDAALTLGRRRARVVRHTDTGVAVRFVLPLRPE 177


>gi|240142085|ref|YP_002966595.1| hypothetical protein MexAM1_META2p0402 [Methylobacterium extorquens
           AM1]
 gi|240012029|gb|ACS43254.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 197

 Score =  131 bits (329), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 49/175 (28%), Positives = 81/175 (46%), Gaps = 5/175 (2%)

Query: 15  AFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEG 74
              R ++ + GR LL DGTE +C VR  S     +       +  +R +  +E+VG + G
Sbjct: 13  RQSRTELLVGGRVLLADGTERSCCVRFDSEDVATVFAAADPAMF-DRVLFRLEEVGSLSG 71

Query: 75  KVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQL 134
            VV  D    + +R+  S   RR++  KL WL        ++ R+  R + R R V  Q 
Sbjct: 72  IVVANDR-ASFEIRLEGSGERRRRVQTKLDWLEA-HAGGREERRSEIRIVPRRRTV--QF 127

Query: 135 VLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEF 189
                   + +++D+S SG S+S+ ++  +   VL       VVR    G+A+ F
Sbjct: 128 RRPGEEPFTTRILDVSPSGASLSMPIRPGIGETVLVGRRYAEVVRHSDEGVAVRF 182


>gi|188582465|ref|YP_001925910.1| type IV pilus assembly PilZ [Methylobacterium populi BJ001]
 gi|179345963|gb|ACB81375.1| type IV pilus assembly PilZ [Methylobacterium populi BJ001]
          Length = 191

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/182 (20%), Positives = 79/182 (43%), Gaps = 4/182 (2%)

Query: 21  VDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFD 80
           V L          ++  + +++SP G+          V E     +  +G++E +VV+ D
Sbjct: 12  VFLPALCWSRRQADFYAVTQDLSPDGITFRSAFEPA-VDESLTCSIRYIGQVETRVVSVD 70

Query: 81  SNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNT 140
            N  + VR++TS     ++A  ++ L+ +     +  RA+ R        D  + L D  
Sbjct: 71  DNL-FVVRLMTSRQRAAEVARTMLALSREQGRSFESARAHPRINP--ARKDVLVTLEDGR 127

Query: 141 KHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFK 200
               ++I++S SG ++++D  +   +++       +VVRIF  GI   F+   +      
Sbjct: 128 VLPGRLINVSASGAALALDHTLASGARITIGATAAQVVRIFRDGIGAAFAFPLDPAQVHA 187

Query: 201 SL 202
            +
Sbjct: 188 EI 189


>gi|163852450|ref|YP_001640493.1| type IV pilus assembly PilZ [Methylobacterium extorquens PA1]
 gi|163664055|gb|ABY31422.1| type IV pilus assembly PilZ [Methylobacterium extorquens PA1]
          Length = 196

 Score =  124 bits (311), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 35/169 (20%), Positives = 75/169 (44%), Gaps = 4/169 (2%)

Query: 34  EYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSE 93
           ++  + +++S  G+          V E     +  +G++E +VV+   N+ + VR++ S 
Sbjct: 30  DFYAVTQDLSRTGITFRSASDPA-VNEPLTCSIRYIGQVEARVVSSGDNQ-FVVRLMASR 87

Query: 94  NERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESG 153
               ++A  ++ LA +     +  RA+ R        D  + L D      ++I++S SG
Sbjct: 88  QRAAEVARTMLALAREQGRSFESARAHPRINP--ARKDVLVTLEDGRVLPGRLINVSSSG 145

Query: 154 VSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSL 202
            ++++D  +   + +   D   +VVRIF  GI   F+   +       +
Sbjct: 146 AALAIDHTLSRGASITIGDTAAKVVRIFRDGIGATFAFPLDPGQVHAGI 194


>gi|218531206|ref|YP_002422022.1| type IV pilus assembly PilZ [Methylobacterium chloromethanicum CM4]
 gi|218523509|gb|ACK84094.1| type IV pilus assembly PilZ [Methylobacterium chloromethanicum CM4]
          Length = 196

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 35/169 (20%), Positives = 75/169 (44%), Gaps = 4/169 (2%)

Query: 34  EYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSE 93
           ++  + +++S  G+          V E     +  +G++E +VV+   N+ + VR++ S 
Sbjct: 30  DFYAVTQDLSRTGITFRSASDPA-VNEPLTCSIRYIGQVEARVVSSGDNQ-FVVRLMASR 87

Query: 94  NERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESG 153
               ++A  ++ LA +     +  RA+ R        D  + L D      ++I++S SG
Sbjct: 88  QRAAEVARTMLALAREQGRTFESARAHPRINP--ARKDVLVTLEDGRVLPGRLINVSSSG 145

Query: 154 VSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSL 202
            ++++D  +   + +   D   +VVRIF  GI   F+   +       +
Sbjct: 146 AALAIDHTLSRGASITIGDTAAKVVRIFRDGIGAAFAFPLDPGQVHAGI 194


>gi|254562200|ref|YP_003069295.1| hypothetical protein METDI3807 [Methylobacterium extorquens DM4]
 gi|254269478|emb|CAX25444.1| hypothetical protein METDI3807 [Methylobacterium extorquens DM4]
          Length = 191

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 75/169 (44%), Gaps = 4/169 (2%)

Query: 34  EYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSE 93
           ++  + +++S  G+          V E     +  +G++E +VV+   N+ + VR++ S 
Sbjct: 25  DFYAVTQDLSRTGITFRSASDPA-VNEPLTCSIRYIGQVEARVVSSGDNQ-FVVRLMASR 82

Query: 94  NERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESG 153
               ++A  ++ LA +     +  RA+ R        D  + L D      ++I++S SG
Sbjct: 83  QRAAEVARTMLALAREQGRTFESARAHPRINP--ARKDVLVTLEDGRVLPGRLINVSSSG 140

Query: 154 VSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSL 202
            ++++D  +   + +   D   +VVR+F  GI   F+   +       +
Sbjct: 141 AALAIDHTLSRGASITIGDTAAKVVRVFRDGIGATFAFPLDPGQVHAGI 189


>gi|240139786|ref|YP_002964263.1| hypothetical protein MexAM1_META1p3242 [Methylobacterium extorquens
           AM1]
 gi|240009760|gb|ACS40986.1| hypothetical protein MexAM1_META1p3242 [Methylobacterium extorquens
           AM1]
          Length = 191

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 75/169 (44%), Gaps = 4/169 (2%)

Query: 34  EYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSE 93
           ++  + +++S  G+          V E     +  +G++E +VV+   N+ + VR++ S 
Sbjct: 25  DFYAVTQDLSRTGITFRSASDPA-VNEPLTCSIRYIGQVEARVVSSGDNQ-FVVRLMASR 82

Query: 94  NERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESG 153
               ++A  ++ LA +     +  RA+ R        D  + L D      ++I++S SG
Sbjct: 83  QRAAEVARTMLALAREQGRTFESARAHPRINP--ARKDVLVTLEDGRVLPGRLINVSSSG 140

Query: 154 VSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSL 202
            ++++D  +   + +   D   +VVR+F  GI   F+   +       +
Sbjct: 141 AALAIDHTLSRGASITIGDTAAKVVRVFRDGIGAAFAFPLDPGQVHAGI 189


>gi|296444790|ref|ZP_06886753.1| type IV pilus assembly PilZ [Methylosinus trichosporium OB3b]
 gi|296257738|gb|EFH04802.1| type IV pilus assembly PilZ [Methylosinus trichosporium OB3b]
          Length = 185

 Score =  119 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 74/166 (44%), Gaps = 8/166 (4%)

Query: 25  GRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRG 84
           GRF   D  +Y C   ++S   + + CD     VG R ++ +E+ G+ EG V+   +  G
Sbjct: 12  GRFTAPDRRDYFCRAIDMSAEVVALRCDYAPD-VGARIVLHLERWGKFEGAVIRVFAG-G 69

Query: 85  YAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSC 144
           + V +  ++  R  +A +L WL+          R++ R   R R +   +         C
Sbjct: 70  FTVGLEVADRGRAHVAMQLAWLSRHAAGA--AFRSHERLTPRRRFITFTVQ---GVTLPC 124

Query: 145 KVIDISESGVSVSVDLQIEMFSKVLFND-ILGRVVRIFPGGIAIEF 189
           +V+D+S SG  +  ++++   + V      +  V R    G A+ F
Sbjct: 125 EVLDLSRSGALLRTEVKVPDGAAVTLGRKTIAEVARQTDQGFAVRF 170



 Score = 43.7 bits (102), Expect = 0.015,   Method: Composition-based stats.
 Identities = 13/65 (20%), Positives = 28/65 (43%), Gaps = 5/65 (7%)

Query: 128 REVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLF-----NDILGRVVRIFP 182
                +    D   + C+ ID+S   V++  D   ++ ++++          G V+R+F 
Sbjct: 8   PRFKGRFTAPDRRDYFCRAIDMSAEVVALRCDYAPDVGARIVLHLERWGKFEGAVIRVFA 67

Query: 183 GGIAI 187
           GG  +
Sbjct: 68  GGFTV 72


>gi|220924042|ref|YP_002499344.1| type IV pilus assembly PilZ [Methylobacterium nodulans ORS 2060]
 gi|219948649|gb|ACL59041.1| type IV pilus assembly PilZ [Methylobacterium nodulans ORS 2060]
          Length = 200

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 47/183 (25%), Positives = 86/183 (46%), Gaps = 5/183 (2%)

Query: 21  VDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFD 80
           + + GR+LL +G E+ C  R  S     ++  VP  L G+   +++  +G + G V+   
Sbjct: 22  LRISGRYLLPNGHEHACETRTFSLTEAELIAAVP-GLPGDPVTIYLNTIGAVTG-VIRSL 79

Query: 81  SNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNT 140
           +  G+ V I      R ++A +L WLA +    + D R+  R +   + V  Q+ L D +
Sbjct: 80  TPAGFIVAIEIGPGRRARIAARLAWLAARASGKI-DQRSDVRIVPATKAV--QVKLPDGS 136

Query: 141 KHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFK 200
                +ID+S +G +++V  +  + + V        VVR   GGIA+ F          +
Sbjct: 137 VLPGSLIDLSMTGAAIAVAARPAVGATVTVGKRFATVVRHLDGGIAVAFRLPFRPETFNE 196

Query: 201 SLI 203
           S++
Sbjct: 197 SVV 199


>gi|240136930|ref|YP_002961397.1| Type IV pilus assembly PilZ [Methylobacterium extorquens AM1]
 gi|240006894|gb|ACS38120.1| Type IV pilus assembly PilZ [Methylobacterium extorquens AM1]
          Length = 185

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/177 (26%), Positives = 75/177 (42%), Gaps = 4/177 (2%)

Query: 19  VKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVN 78
           + V L GR LL  G E +C+ R      + +V       VG R I  V+ +G IE  V  
Sbjct: 4   MPVALAGRILLPCGAERDCLCRLSRADEVYVVIGDASAAVGSRVICHVDGLGVIEASVTT 63

Query: 79  FDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLND 138
             S     + +  S     +LA +L W   + D   +D R   R I  D  V  ++ L+D
Sbjct: 64  V-SRGSLRLSVEGSPAHMARLATRLAWHRARLD-GREDQRGAMRVIPLDPSV--EVTLSD 119

Query: 139 NTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQES 195
                 ++ D+S +G ++ + L+  + + +       RVVR    GIA+ F      
Sbjct: 120 GMAVEARIADLSATGAALEMVLRPPVDAVLTVGRRRARVVRQTDAGIAVRFVLPLRP 176


>gi|170751465|ref|YP_001757725.1| type IV pilus assembly PilZ [Methylobacterium radiotolerans JCM
           2831]
 gi|170657987|gb|ACB27042.1| type IV pilus assembly PilZ [Methylobacterium radiotolerans JCM
           2831]
          Length = 179

 Score =  104 bits (259), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 32/171 (18%), Positives = 69/171 (40%), Gaps = 4/171 (2%)

Query: 32  GTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVT 91
             ++  +  ++S  G+       +   GE     +  +G +E ++        + V +  
Sbjct: 11  RRDFYAVTADVSTEGIRFRSS-SLLAPGEDLTCSIRHIGTLEARIARVAGQE-FIVCVRG 68

Query: 92  SENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISE 151
                  LA + + LA   DL  +  RA+ R + R +    Q+           V+++S 
Sbjct: 69  GRAILTDLARQFVTLARAQDLQPEPVRAHRRIVPRQK--IVQVTTATGEAFQGHVLNVSA 126

Query: 152 SGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSL 202
           SGV++ VD ++E+ + +        V+R F  G+   FS     +   +++
Sbjct: 127 SGVALLVDHELEIGAMIRVGRKTATVMRHFTHGVGAAFSEPFAPSAVHEAM 177


>gi|23004164|ref|ZP_00047641.1| COG0532: Translation initiation factor 2 (IF-2; GTPase)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 100

 Score = 80.3 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 47/100 (47%), Gaps = 2/100 (2%)

Query: 103 LIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQI 162
           ++ LA++ +  L+  R + R    +R  D  + L D      ++I++S SG ++ ++  +
Sbjct: 1   MLALAHEQERPLEAWRLHARINPVNR--DVLVTLEDGRVLPGRLINVSASGAALVIEDTV 58

Query: 163 EMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSL 202
           E  + ++      RVVR+F  GI   F +  +       +
Sbjct: 59  ERGAHIVIGSTAARVVRVFRDGIGAAFVTPFDPVQVHAGI 98


>gi|218663518|ref|ZP_03519448.1| type IV pilus assembly PilZ [Rhizobium etli IE4771]
          Length = 58

 Score = 76.0 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 36/58 (62%)

Query: 145 KVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSL 202
           +++D+S SG +V V+++  + + V   ++ GRVVR F  G+AIEF S+Q      + L
Sbjct: 1   RIMDLSLSGAAVDVEMRPSIGTAVRLGNMRGRVVRHFVEGVAIEFLSIQSRETLREFL 58


>gi|240142365|ref|YP_002966875.1| hypothetical protein MexAM1_META2p0689 [Methylobacterium extorquens
           AM1]
 gi|240012309|gb|ACS43534.1| Hypothetical protein MexAM1_META2p0689 [Methylobacterium extorquens
           AM1]
          Length = 189

 Score = 72.2 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 37/178 (20%), Positives = 71/178 (39%), Gaps = 6/178 (3%)

Query: 15  AFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEG 74
           A Q + + L     + D  ++  +  ++S  G+ +     +   GE     +  +   EG
Sbjct: 6   AVQPLTIVLPAFCRVPDRIDFYAVTGDVSMRGVRLRSA-SLPRRGEVVECRIRGIDPFEG 64

Query: 75  KVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQL 134
           +VV       + V++  +      +A +L              R + R + R    D ++
Sbjct: 65  RVVQVTQTD-FTVKVGGASP--GVIARQLFEAGRSQPKPEPPVRVHPRFVPR--RTDVEV 119

Query: 135 VLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSV 192
             +D    + +++++S SGV+V+    +E  S V     L RVVR F GG    F   
Sbjct: 120 ARSDGQSFAARILNLSASGVAVAAARYVEPDSIVTIGATLARVVRRFEGGFGAAFLQP 177


>gi|304321680|ref|YP_003855323.1| hypothetical protein PB2503_10649 [Parvularcula bermudensis
           HTCC2503]
 gi|303300582|gb|ADM10181.1| hypothetical protein PB2503_10649 [Parvularcula bermudensis
           HTCC2503]
          Length = 217

 Score = 55.2 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 68/175 (38%), Gaps = 5/175 (2%)

Query: 16  FQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGK 75
           F+ V  +L    L+    E+ C VR IS  G  I         G R+++++    R  G 
Sbjct: 4   FKSVHTNLHATVLIGADEEWECRVRRISAKGFLIQGVQGQPDEGTRAVLYLNANERFVG- 62

Query: 76  VVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLV 135
           ++   +   +A  +  S+ +R +  + +          + +         R R    ++ 
Sbjct: 63  ILRQAAKY-FA-TLSISDQQRARAIECMDLYEGTAPPRVANRIGDEPVENRVRIEPKEVT 120

Query: 136 --LNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIE 188
             L +  + + ++ D+S SG+ VS+   +   S V    +  RV R    G   E
Sbjct: 121 VLLKNGDEVTGQLTDVSRSGLGVSMPAVLSPTSIVTIGGLTLRVKRTHTLGYGFE 175


>gi|254504525|ref|ZP_05116676.1| Type IV pilus assembly protein PilZ [Labrenzia alexandrii DFL-11]
 gi|222440596|gb|EEE47275.1| Type IV pilus assembly protein PilZ [Labrenzia alexandrii DFL-11]
          Length = 810

 Score = 53.3 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/89 (19%), Positives = 37/89 (41%), Gaps = 8/89 (8%)

Query: 113 HLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLF-- 170
            ++D R   R   +    D  +      K + ++ID+S +G  +    ++ +  K++   
Sbjct: 719 DVEDRRKAAR---KAISEDVTITFGQGKKRTVQLIDVSTTGAQIMDMSELALGEKLVLDF 775

Query: 171 ---NDILGRVVRIFPGGIAIEFSSVQESN 196
              + + G VVR    G  +EF+     +
Sbjct: 776 LDGSRLQGTVVRHTGAGCGVEFADALPHD 804


>gi|118588233|ref|ZP_01545642.1| methyl-accepting chemotaxis protein [Stappia aggregata IAM 12614]
 gi|118438939|gb|EAV45571.1| methyl-accepting chemotaxis protein [Stappia aggregata IAM 12614]
          Length = 810

 Score = 49.1 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 33/84 (39%), Gaps = 8/84 (9%)

Query: 113 HLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLF-- 170
            ++D R   R   +    D  L   +  K + +++D+S +G  +     +    ++    
Sbjct: 719 DVEDRRRATR---KAISEDVTLTCANGHKRTAQLVDVSITGAQILNVTDLPNGERLTLEF 775

Query: 171 --NDI-LGRVVRIFPGGIAIEFSS 191
               +   +VVR    G  +EF+ 
Sbjct: 776 LDGTVLQAKVVRQTGAGCGVEFAE 799


>gi|158424973|ref|YP_001526265.1| methyl-accepting chemotaxis sensory transducer [Azorhizobium
           caulinodans ORS 571]
 gi|158331862|dbj|BAF89347.1| methyl-accepting chemotaxis sensory transducer [Azorhizobium
           caulinodans ORS 571]
          Length = 581

 Score = 47.9 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 2/90 (2%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           +      D+R F R  V++ GR     GT       ++S GG  +    P   VGER  +
Sbjct: 311 LRQTPLGDRRKFDRWPVEISGRLSHAGGTASV-KTLDLSMGGALLAAVTPTPRVGERITL 369

Query: 65  FVEKVGRIEGKVVNFDSNRGYAVRIVTSEN 94
            +  +G + G++    S  G  +    +++
Sbjct: 370 DLPGLGALPGRIAAN-SPLGCHIAFERTDH 398


>gi|27377559|ref|NP_769088.1| cellulose synthase catalytic subunit [Bradyrhizobium japonicum USDA
           110]
 gi|27350703|dbj|BAC47713.1| bll2448 [Bradyrhizobium japonicum USDA 110]
          Length = 646

 Score = 47.9 bits (113), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 17/82 (20%), Positives = 28/82 (34%), Gaps = 10/82 (12%)

Query: 115 QDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIE-----MFSKVL 169
              R   R        +  L+  D   H  ++ DIS +G  + +D         +  ++ 
Sbjct: 531 PRKRKAERF----DRNEPILLRQDGKWHLARLADISITGARL-IDPDPPAPGSTIDCRIY 585

Query: 170 FNDILGRVVRIFPGGIAIEFSS 191
              I   VVR    G A+ F  
Sbjct: 586 GRSIAAIVVRRTTDGFAVRFEE 607


>gi|209519566|ref|ZP_03268358.1| cellulose synthase catalytic subunit (UDP-forming) [Burkholderia
           sp. H160]
 gi|209499983|gb|EEA00047.1| cellulose synthase catalytic subunit (UDP-forming) [Burkholderia
           sp. H160]
          Length = 858

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 35/91 (38%), Gaps = 7/91 (7%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVC-DVPMFLVGERSIVFVEKVGRI 72
           R   R+ + +    LL +G    C     S GGL +          GER  V + + G I
Sbjct: 707 RVSHRIPLHVPATLLLPNGRTLACRTINYSIGGLGLALPPGAKVTTGERVGVCLSR-GHI 765

Query: 73  E----GKVVNFDSNRGYAVRIVTSENERRKL 99
           E    G +V   +     +R+  +    R++
Sbjct: 766 EHCFPGVIVRTGARET-GIRLELTPEMERQV 795



 Score = 36.8 bits (84), Expect = 1.9,   Method: Composition-based stats.
 Identities = 13/64 (20%), Positives = 26/64 (40%), Gaps = 5/64 (7%)

Query: 113 HLQDCRAYGRKITRDR-EVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFN 171
            +       R   R    V A L+L +    +C+ I+ S  G+ +++       +KV   
Sbjct: 698 GVAQEARQVRVSHRIPLHVPATLLLPNGRTLACRTINYSIGGLGLALPP----GAKVTTG 753

Query: 172 DILG 175
           + +G
Sbjct: 754 ERVG 757


>gi|319788003|ref|YP_004147478.1| cellulose synthase catalytic subunit (UDP-forming)
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317466515|gb|ADV28247.1| cellulose synthase catalytic subunit (UDP-forming)
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 715

 Score = 45.2 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 41/117 (35%), Gaps = 14/117 (11%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVP-MFLVGERSIVFVEKVG-- 70
           R   RV + +     + DGT   C   + S GG+ +  D P     G    V +   G  
Sbjct: 563 RRAHRVPLRMPAVLHMPDGTAVPCHTVDFSTGGMALRPDSPYPMAPGTEVQVELGHRGRS 622

Query: 71  -RIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWL----ANKDDLHLQDCRAYGR 122
            R+   V      +G ++     + E+ +      WL      + DL +     + R
Sbjct: 623 YRLPAVVRQDRDEQGVSIEFQELDLEQER------WLVASTFARADLWMSQWGRHDR 673



 Score = 39.8 bits (92), Expect = 0.23,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 33/86 (38%), Gaps = 14/86 (16%)

Query: 118 RAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEM--FSKVLFN-DIL 174
           R   R   R   V   L + D T   C  +D S  G+++  D    M   ++V       
Sbjct: 563 RRAHRVPLRMPAV---LHMPDGTAVPCHTVDFSTGGMALRPDSPYPMAPGTEVQVELGHR 619

Query: 175 GR------VVRIFPG--GIAIEFSSV 192
           GR      VVR      G++IEF  +
Sbjct: 620 GRSYRLPAVVRQDRDEQGVSIEFQEL 645


>gi|117924695|ref|YP_865312.1| type IV pilus assembly PilZ [Magnetococcus sp. MC-1]
 gi|117608451|gb|ABK43906.1| type IV pilus assembly PilZ [Magnetococcus sp. MC-1]
          Length = 417

 Score = 44.8 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 33/76 (43%), Gaps = 6/76 (7%)

Query: 117 CRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQI-EMFSKV---LFND 172
            R + R   +D      +VL D  K S +++DIS +G+ V            V   +  +
Sbjct: 297 DRNHIRVKPKDP--VNVVVLGDGRKLSGELLDISATGMGVVCGGTPIPFGEPVECNMVLE 354

Query: 173 ILGRVVRIFPGGIAIE 188
             G+ +R+    +A++
Sbjct: 355 KKGQTLRVSGSIVAVK 370


>gi|163794441|ref|ZP_02188412.1| hypothetical protein BAL199_04489 [alpha proteobacterium BAL199]
 gi|159180165|gb|EDP64688.1| hypothetical protein BAL199_04489 [alpha proteobacterium BAL199]
          Length = 155

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 16/95 (16%), Positives = 38/95 (40%), Gaps = 8/95 (8%)

Query: 115 QDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVL----- 169
            + R +  ++    E     ++ D  +    ++DIS  GV +  D Q+   +K+      
Sbjct: 57  PESRRHHLRVP---EAIGTALMVDGREVDAVIVDISVGGVGMVTDEQLPAGTKLRVAVPP 113

Query: 170 FNDILGRVVRIFPGGIAIEFSSVQESNIAFKSLIN 204
              I   VV      + + F +   ++   ++L++
Sbjct: 114 VGWIEAEVVATDDDRLHVRFRTDDATSDQQRALLD 148



 Score = 37.5 bits (86), Expect = 1.1,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 2/71 (2%)

Query: 13  QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRI 72
           +R   RV  +  G  L+ DG E + ++ +IS GG+ +V D  +   G +  V V  VG I
Sbjct: 60  RRHHLRVP-EAIGTALMVDGREVDAVIVDISVGGVGMVTDEQLPA-GTKLRVAVPPVGWI 117

Query: 73  EGKVVNFDSNR 83
           E +VV  D +R
Sbjct: 118 EAEVVATDDDR 128


>gi|197117398|ref|YP_002137825.1| PilZ domain-containing protein [Geobacter bemidjiensis Bem]
 gi|197086758|gb|ACH38029.1| PilZ domain protein [Geobacter bemidjiensis Bem]
          Length = 124

 Score = 44.1 bits (103), Expect = 0.011,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 44/105 (41%), Gaps = 17/105 (16%)

Query: 114 LQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFN-- 171
           ++D R + R         + L+  +      +V D+S  G+ +  D QI M S V     
Sbjct: 1   MKDRRNFSRV----EFRVSALLQAEGVAIKGEVTDVSLHGLYMETDEQIPMGSPVEITIY 56

Query: 172 ----------DILGRVVRIFPGGIAIEFSSVQESNIAF-KSLINH 205
                     ++ G V R+ PGGI   F  +   + A  +S+I++
Sbjct: 57  LSATTEPVVINVKGTVARLVPGGIGCAFDKMDIESFAHLRSIISY 101


>gi|114778692|ref|ZP_01453504.1| hypothetical protein SPV1_13492 [Mariprofundus ferrooxydans PV-1]
 gi|114551054|gb|EAU53616.1| hypothetical protein SPV1_13492 [Mariprofundus ferrooxydans PV-1]
          Length = 155

 Score = 43.3 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 42/96 (43%), Gaps = 14/96 (14%)

Query: 122 RKITRDREVDAQLVLNDNTK-HSCKVIDISESGVSVSVDLQIEMFSK----VLFND---- 172
           R  +R +     ++  +  +    +V+D+S SGV +  D  + M ++    +L       
Sbjct: 36  RNYSRSKVSVGAVLSPEGKEPFGVEVVDLSMSGVFLHSDTALPMGTRCQLSILLGHFKHE 95

Query: 173 ----ILGRVVRIFPGGIAIEFSSVQ-ESNIAFKSLI 203
                 G VVR    GIA+ F SV+ ES    + L+
Sbjct: 96  LPIITEGTVVRTDKKGIALRFESVKVESAPKLEELV 131


>gi|319648310|ref|ZP_08002527.1| hypothetical protein HMPREF1012_03566 [Bacillus sp. BT1B_CT2]
 gi|317389945|gb|EFV70755.1| hypothetical protein HMPREF1012_03566 [Bacillus sp. BT1B_CT2]
          Length = 508

 Score = 42.9 bits (100), Expect = 0.024,   Method: Composition-based stats.
 Identities = 36/196 (18%), Positives = 65/196 (33%), Gaps = 35/196 (17%)

Query: 8   LQFIDQRAFQ---RVKVDLKGRFLLFDGTEYNCIVREISPGGLCI----VCDVPMFLVGE 60
           L   D+  F+   R  V+    F      E+ C + ++S  G  I      D  M+   +
Sbjct: 271 LVAFDRPRFRSSERFTVNKPAAFSTVSVDEHKCELIDVSDTGARIRLPYTADSDMYYHVD 330

Query: 61  RSIVFVEKVGRIEGKVVNFDSNR---------------------GYAV-RIVTSENERRK 98
             I  ++ VG++  +V+    +                      G+        + +R K
Sbjct: 331 GLI--IDAVGKVPARVMWTTKDEADIEIGLHFKEMDKELYVKLIGFMFNEENAKKADREK 388

Query: 99  LADKLI----WLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGV 154
            AD L     +L   +       R Y R+  +          ++   H   + DIS SG 
Sbjct: 389 RADTLSTVIRFLTKTEKSPDAFKRKYVREAFQGLGTLLFPRDSEKGAHEVMIKDISLSGC 448

Query: 155 SVSVDLQIEMFSKVLF 170
            +     +E+   VL 
Sbjct: 449 QIESGFPLEINEHVLV 464


>gi|52082435|ref|YP_081226.1| glycosyl transferase family protein [Bacillus licheniformis ATCC
           14580]
 gi|52787831|ref|YP_093660.1| hypothetical protein BLi04154 [Bacillus licheniformis ATCC 14580]
 gi|52005646|gb|AAU25588.1| putative Glycosyl transferase, family 2 [Bacillus licheniformis
           ATCC 14580]
 gi|52350333|gb|AAU42967.1| conserved hypothetical protein [Bacillus licheniformis ATCC 14580]
          Length = 752

 Score = 42.9 bits (100), Expect = 0.024,   Method: Composition-based stats.
 Identities = 36/196 (18%), Positives = 65/196 (33%), Gaps = 35/196 (17%)

Query: 8   LQFIDQRAFQ---RVKVDLKGRFLLFDGTEYNCIVREISPGGLCI----VCDVPMFLVGE 60
           L   D+  F+   R  V+    F      E+ C + ++S  G  I      D  M+   +
Sbjct: 515 LVAFDRPRFRSSERFTVNKPAAFSTVSVDEHKCELIDVSDTGARIRLPYTADSDMYYHVD 574

Query: 61  RSIVFVEKVGRIEGKVVNFDSNR---------------------GYAV-RIVTSENERRK 98
             I  ++ VG++  +V+    +                      G+        + +R K
Sbjct: 575 GLI--IDAVGKVPARVMWTTKDEADIEIGLHFKEMDKELYVKLIGFMFNEENAKKADREK 632

Query: 99  LADKLI----WLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGV 154
            AD L     +L   +       R Y R+  +          ++   H   + DIS SG 
Sbjct: 633 RADTLSTVIRFLTKTEKSPDAFKRKYVREAFQGLGTLLFPRDSEKGAHEVMIKDISLSGC 692

Query: 155 SVSVDLQIEMFSKVLF 170
            +     +E+   VL 
Sbjct: 693 QIESGFPLEINEHVLV 708


>gi|220936203|ref|YP_002515102.1| hypothetical protein Tgr7_3046 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997513|gb|ACL74115.1| conserved hypothetical protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 91

 Score = 42.9 bits (100), Expect = 0.026,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 35/88 (39%), Gaps = 17/88 (19%)

Query: 116 DCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSV--SVDLQIEMFSKV----- 168
           D R + R      EV+ +L +        +  D+S SGV +    + +  + ++V     
Sbjct: 4   DRRRHPRIP---MEVEVELHVPAEALRVVRTRDLSGSGVLLLMPAEGRPAIGARVQVRVV 60

Query: 169 -LFND------ILGRVVRIFPGGIAIEF 189
               D      +   VVR  P G+A+ F
Sbjct: 61  GALGDGDAPPLVPATVVRDLPEGVAVAF 88


>gi|322420974|ref|YP_004200197.1| type IV pilus assembly PilZ [Geobacter sp. M18]
 gi|320127361|gb|ADW14921.1| type IV pilus assembly PilZ [Geobacter sp. M18]
          Length = 125

 Score = 42.5 bits (99), Expect = 0.031,   Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 44/105 (41%), Gaps = 17/105 (16%)

Query: 114 LQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFN-- 171
           ++D R + R         + L+  +      +V D+S  G+ +  + ++ + + V     
Sbjct: 2   MKDRRNFSRV----DFRVSALLQAEGVAIKGEVSDVSLHGLYMETEEELPVGTPVEVTIY 57

Query: 172 ----------DILGRVVRIFPGGIAIEFSSVQESNIAF-KSLINH 205
                     ++ G V R+ PGGI   F  +   + A  +S+I++
Sbjct: 58  LSATPEPIVINVKGTVARLVPGGIGCSFDKMDVESFAHLRSIISY 102


>gi|253701847|ref|YP_003023036.1| type IV pilus assembly PilZ [Geobacter sp. M21]
 gi|251776697|gb|ACT19278.1| type IV pilus assembly PilZ [Geobacter sp. M21]
          Length = 124

 Score = 42.1 bits (98), Expect = 0.044,   Method: Composition-based stats.
 Identities = 23/105 (21%), Positives = 43/105 (40%), Gaps = 17/105 (16%)

Query: 114 LQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFN-- 171
           ++D R + R         + L+  +      +V D+S  G+ +  D  I + S V     
Sbjct: 1   MKDRRNFSRV----EFRVSALLQAEGVAIKGEVTDVSLHGLYMETDELIPVGSPVEITIY 56

Query: 172 ----------DILGRVVRIFPGGIAIEFSSVQESNIAF-KSLINH 205
                     ++ G V R+ PGGI   F  +   + A  +S+I++
Sbjct: 57  LSATTEPVVINVKGTVARLVPGGIGCAFDKMDIESFAHLRSIISY 101


>gi|116694734|ref|YP_728945.1| glycosyltransferase [Ralstonia eutropha H16]
 gi|113529233|emb|CAJ95580.1| Glycosyltransferase [Ralstonia eutropha H16]
          Length = 653

 Score = 41.8 bits (97), Expect = 0.057,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 27/73 (36%), Gaps = 11/73 (15%)

Query: 114 LQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEM--FSKVLF- 170
           L   R   R         A L+  D  ++     D+S +GV+V+  L   +   ++    
Sbjct: 533 LPRPRKEERF----PHRAAALLRVDGKEYRVTTRDLSCNGVAVTTPLAPAIPAGTEGALW 588

Query: 171 ----NDILGRVVR 179
                 I  RVVR
Sbjct: 589 LAQAGWIPCRVVR 601


>gi|222056295|ref|YP_002538657.1| type IV pilus assembly PilZ [Geobacter sp. FRC-32]
 gi|221565584|gb|ACM21556.1| type IV pilus assembly PilZ [Geobacter sp. FRC-32]
          Length = 88

 Score = 41.8 bits (97), Expect = 0.057,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 35/85 (41%), Gaps = 15/85 (17%)

Query: 116 DCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKV------- 168
           + R + R        D  +  N+ T +S  V D+S  G  V+ D+ I +   V       
Sbjct: 2   EKRKFARLA---MHSDTNIKFNN-TMYSGTVRDLSMKGAFVTTDVLIPVNETVEVTIYTS 57

Query: 169 ----LFNDILGRVVRIFPGGIAIEF 189
               +  D+  +V+R    GI +EF
Sbjct: 58  STPNMLCDLQAKVIRSTEYGIGLEF 82


>gi|167042421|gb|ABZ07147.1| hypothetical protein ALOHA_HF4000ANIW133B20ctg1g9 [uncultured
           marine microorganism HF4000_ANIW133B20]
          Length = 237

 Score = 41.4 bits (96), Expect = 0.068,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 33/89 (37%), Gaps = 8/89 (8%)

Query: 6   HNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVF 65
           H +Q    R   R+KVD++GR  L D T     +  IS  G  I+ D  +  V  + ++ 
Sbjct: 111 HAIQVKKIRREMRIKVDIEGRLGLQDRTILPVKLTNISATGCQILVDRDIGKVDGQVVLN 170

Query: 66  VEKVGRIEGKVVNFDSNRGYAVRIVTSEN 94
                     +     +   A+ +     
Sbjct: 171 F--------NIAQLHDDETSAMTLEAKVR 191


>gi|91775201|ref|YP_544957.1| hypothetical protein Mfla_0848 [Methylobacillus flagellatus KT]
 gi|91775345|ref|YP_545101.1| hypothetical protein Mfla_0992 [Methylobacillus flagellatus KT]
 gi|91709188|gb|ABE49116.1| hypothetical protein Mfla_0848 [Methylobacillus flagellatus KT]
 gi|91709332|gb|ABE49260.1| hypothetical protein Mfla_0992 [Methylobacillus flagellatus KT]
          Length = 221

 Score = 41.4 bits (96), Expect = 0.080,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 33/89 (37%), Gaps = 8/89 (8%)

Query: 6   HNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVF 65
           H +Q    R   R+KVD++GR  L D T     +  IS  G  I+ D  +  V  + ++ 
Sbjct: 95  HAIQVKKIRREMRIKVDIEGRLGLQDRTILPVKLTNISATGCQILVDRDIGKVDGQVVLN 154

Query: 66  VEKVGRIEGKVVNFDSNRGYAVRIVTSEN 94
                     +     +   A+ +     
Sbjct: 155 F--------NIAQLHDDETSAMTLEAKVR 175


>gi|323490164|ref|ZP_08095384.1| hypothetical protein GPDM_12457 [Planococcus donghaensis MPA1U2]
 gi|323396212|gb|EGA89038.1| hypothetical protein GPDM_12457 [Planococcus donghaensis MPA1U2]
          Length = 116

 Score = 41.0 bits (95), Expect = 0.091,   Method: Composition-based stats.
 Identities = 22/113 (19%), Positives = 45/113 (39%), Gaps = 9/113 (7%)

Query: 13  QRAFQRVKVD--LKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
           +R F RV  +  L G+  ++ G+     + ++S GGL     + +  +GE      E + 
Sbjct: 5   RREFFRVSFNQALSGKVSVYGGSFLPIQIYDVSAGGLVFSSPLNLP-IGESVSCSFELLE 63

Query: 71  R---IEGKVVNFDSNRGYA---VRIVTSENERRKLADKLIWLANKDDLHLQDC 117
           +   +EG +V   +        V    S+    +L  +L +   +    L + 
Sbjct: 64  KDFLLEGAIVRKATGVDVVECGVEFSVSQGASSELFKQLNYYQIRQRKSLLED 116


>gi|299135205|ref|ZP_07028396.1| type IV pilus assembly PilZ [Afipia sp. 1NLS2]
 gi|298590182|gb|EFI50386.1| type IV pilus assembly PilZ [Afipia sp. 1NLS2]
          Length = 89

 Score = 40.6 bits (94), Expect = 0.13,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 34/83 (40%), Gaps = 8/83 (9%)

Query: 118 RAYGRKITRDREVDAQLVLNDN-TKHSCKVIDISESGVSVSVDLQIEMFSKVLFN----- 171
           +   RK     ++ A L L+    K  C ++D+S +G  +SV    ++ SK+        
Sbjct: 5   KRESRKARHQTQLGAWLTLDGGFAKRPCTIVDLSATGARLSVQNGGKLGSKIALALTMDV 64

Query: 172 --DILGRVVRIFPGGIAIEFSSV 192
                 R+V      I +EF  V
Sbjct: 65  RKLTPCRLVWQRGNEIGVEFVHV 87


>gi|296282570|ref|ZP_06860568.1| hypothetical protein CbatJ_03060 [Citromicrobium bathyomarinum
           JL354]
          Length = 249

 Score = 40.6 bits (94), Expect = 0.15,   Method: Composition-based stats.
 Identities = 31/195 (15%), Positives = 59/195 (30%), Gaps = 37/195 (18%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           D+R  +R     K   L+  G  +  I+R +S GG  +   V +   G+  + + + + +
Sbjct: 28  DRRKNERQIATFKLACLMVRGEAHPAILRNVSDGGAMLEALVAV-NPGDAVVYWWDGIAQ 86

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVD 131
           +E +V     NR     I                                  + R R   
Sbjct: 87  VEARVAWVKGNRLGLANISGPPQ--------------------------PLAVPRQRATR 120

Query: 132 AQLVLNDNTKHSCK-----VIDISESGVSVSVDLQIEMFS--KVLFNDIL---GRVVRIF 181
             + +      +C+     + DIS +G++      I   +   +           +VRI 
Sbjct: 121 IPVRVPVRVWAACRGHWGELTDISLTGLAAKGLQGIAPGTLCTIELGGQALHNATLVRID 180

Query: 182 PGGIAIEFSSVQESN 196
                I F       
Sbjct: 181 GEVAGIRFERPLPPA 195


>gi|304394234|ref|ZP_07376157.1| type IV pilus assembly protein PilZ [Ahrensia sp. R2A130]
 gi|303293674|gb|EFL88051.1| type IV pilus assembly protein PilZ [Ahrensia sp. R2A130]
          Length = 280

 Score = 40.2 bits (93), Expect = 0.16,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 35/80 (43%), Gaps = 4/80 (5%)

Query: 117 CRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLF----ND 172
            +   RK  R +     +++ +  +    +ID+S SG  +     +E  +++       +
Sbjct: 181 DKMESRKARRYKLSLEAVMVLEGRETIAFIIDLSSSGAKLECIATVEKDTRIKLLVDDLE 240

Query: 173 ILGRVVRIFPGGIAIEFSSV 192
           I  RVV    G I ++F++ 
Sbjct: 241 IPARVVWSGGGNIGLQFTTP 260


>gi|291519664|emb|CBK74885.1| PilZ domain [Butyrivibrio fibrisolvens 16/4]
          Length = 220

 Score = 40.2 bits (93), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/87 (16%), Positives = 32/87 (36%), Gaps = 8/87 (9%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR 71
           ++R   RV V   G  ++ DG  ++  V ++S  G+  + +     +G++  +       
Sbjct: 108 ERREDARVMVKKPGSAMMEDGRRFSISVIDVSDSGVSFIGNANRVTIGDKVEINFAD--- 164

Query: 72  IEGKVVNFDSNRGYAVRIVTSENERRK 98
                    ++   A+       E  K
Sbjct: 165 -----TAHKTDFSLAILAQIVRAEAEK 186



 Score = 37.5 bits (86), Expect = 0.98,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 33/78 (42%), Gaps = 16/78 (20%)

Query: 115 QDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVS-VSVDLQIEMFSKVLFN-- 171
            + R   R + +        ++ D  + S  VID+S+SGVS +    ++ +  KV  N  
Sbjct: 107 SERREDARVMVKKPGSA---MMEDGRRFSISVIDVSDSGVSFIGNANRVTIGDKVEINFA 163

Query: 172 ----------DILGRVVR 179
                      IL ++VR
Sbjct: 164 DTAHKTDFSLAILAQIVR 181


>gi|289207423|ref|YP_003459489.1| type IV pilus assembly PilZ [Thioalkalivibrio sp. K90mix]
 gi|288943054|gb|ADC70753.1| type IV pilus assembly PilZ [Thioalkalivibrio sp. K90mix]
          Length = 103

 Score = 39.8 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 36/98 (36%), Gaps = 25/98 (25%)

Query: 116 DCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFN---- 171
           + R + R      EV A+   +D ++      DIS  G  ++ + + +    VL      
Sbjct: 4   ERRRHPRI-PMTVEVVAEC--SDGSQVRLTTNDISGGGAFLAWEDRDQSGIDVLKGLGPG 60

Query: 172 ------------------DILGRVVRIFPGGIAIEFSS 191
                              +  +VVR+   G+A++F S
Sbjct: 61  DQFMLQVFGLLGDGGEPPRVQAQVVRVMEDGVAVQFDS 98


>gi|209884863|ref|YP_002288720.1| type IV pilus assembly PilZ [Oligotropha carboxidovorans OM5]
 gi|209873059|gb|ACI92855.1| type IV pilus assembly PilZ [Oligotropha carboxidovorans OM5]
          Length = 88

 Score = 39.8 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 17/82 (20%), Positives = 32/82 (39%), Gaps = 8/82 (9%)

Query: 118 RAYGRKITRDREVDAQLVLNDN-TKHSCKVIDISESGVSVSVDLQIEMFSKVL------F 170
           +   RK     ++   L L+    K  C ++D+S SG  ++V    ++ +K+        
Sbjct: 5   KREARKPRHKIQLGVWLTLDGGFAKRPCTILDLSTSGARLAVSNSGKLGNKLALALTKDV 64

Query: 171 ND-ILGRVVRIFPGGIAIEFSS 191
                 R+V      I +EF  
Sbjct: 65  GKLTPCRLVWQRGDEIGVEFVQ 86


>gi|325914218|ref|ZP_08176568.1| cellulose synthase catalytic subunit (UDP-forming) [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325539473|gb|EGD11119.1| cellulose synthase catalytic subunit (UDP-forming) [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 714

 Score = 39.8 bits (92), Expect = 0.23,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 41/117 (35%), Gaps = 15/117 (12%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVP-MFLVGERSIVFVEKVGRI 72
           R+  RV +D+     L DG    C     S GG+ I    P     G    + +   G +
Sbjct: 562 RSAHRVPLDVPVNLYLPDGAALACRSVNFSTGGMAIKLAQPQPIEPGSAVQIGLSHRG-V 620

Query: 73  EGK---VVNFDSNRGYAVRIVTSENERRKLADKLIWL----ANKDDLHLQDCRAYGR 122
           E     VV  D +   +++      E+ +      WL      + D+ L     + R
Sbjct: 621 EQTLPAVVRQDRDGQVSIQFTQMSMEQER------WLVASTFARADIWLSQWGQHDR 671



 Score = 36.8 bits (84), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/85 (21%), Positives = 33/85 (38%), Gaps = 11/85 (12%)

Query: 119 AYGRKITRDR-EVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEM--FSKVLFN---- 171
              R   R   +V   L L D    +C+ ++ S  G+++ +     +   S V       
Sbjct: 559 RQVRSAHRVPLDVPVNLYLPDGAALACRSVNFSTGGMAIKLAQPQPIEPGSAVQIGLSHR 618

Query: 172 ---DILGRVVRIFPGG-IAIEFSSV 192
                L  VVR    G ++I+F+ +
Sbjct: 619 GVEQTLPAVVRQDRDGQVSIQFTQM 643


>gi|313499297|gb|ADR60663.1| BcsA [Pseudomonas putida BIRD-1]
          Length = 244

 Score = 39.8 bits (92), Expect = 0.23,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVC-DVPMFLVGERS 62
           R   RV + L    +L  G  Y C + + S GG+ +          GE+ 
Sbjct: 71  RRAHRVPMRLPAGLMLASGHAYPCTLVDYSDGGIGLQVQPGLELKPGEQV 120


>gi|319789137|ref|YP_004150770.1| type IV pilus assembly PilZ [Thermovibrio ammonificans HB-1]
 gi|317113639|gb|ADU96129.1| type IV pilus assembly PilZ [Thermovibrio ammonificans HB-1]
          Length = 209

 Score = 39.8 bits (92), Expect = 0.24,   Method: Composition-based stats.
 Identities = 31/147 (21%), Positives = 51/147 (34%), Gaps = 28/147 (19%)

Query: 43  SPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRG---------YAVRIVTSE 93
            PGG  I   +     GE            EG V    S  G         + +    S 
Sbjct: 15  CPGGREITVPILFSFKGEE---------SEEGVVATSFSPPGIVEILKKRQFFLIKENSR 65

Query: 94  NERRKLADKLIW------LANKDDLHLQDCRAYGRKI-TRDREVDAQLVLNDNTKHSCKV 146
                +  K+ W      L   D+  +++ R Y R +   +   + +L L +  +   KV
Sbjct: 66  RRTVLVKGKVKWCKGNSCLFQLDEEVIEEKRFYERFVFCPEELGEFELHLKNGERIPVKV 125

Query: 147 IDISESGVSVSVDLQIEMFSKVLFNDI 173
           +DIS SG+ + V+       KV   + 
Sbjct: 126 LDISMSGIKLLVE---RYGEKVSAGET 149


>gi|158520869|ref|YP_001528739.1| type IV pilus assembly PilZ [Desulfococcus oleovorans Hxd3]
 gi|158509695|gb|ABW66662.1| type IV pilus assembly PilZ [Desulfococcus oleovorans Hxd3]
          Length = 356

 Score = 39.8 bits (92), Expect = 0.25,   Method: Composition-based stats.
 Identities = 28/161 (17%), Positives = 56/161 (34%), Gaps = 34/161 (21%)

Query: 60  ERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTS------ENERRKL-------ADKLIWL 106
           E +I   + +GR  G +     +    + +V S         R K+       A ++  L
Sbjct: 154 EPAINSADSIGRYSG-LSVLIGSVAVLISVVLSCLVLLYARRRIKMEKEIVNTAGQVEAL 212

Query: 107 AN------KDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDL 160
            +      K+    ++ R + R     R    + VL +   +   + DIS  G  +    
Sbjct: 213 RHTIENIYKNPDDAKEKREHTRVPGLVR---VEFVLAN-QAYLGVIKDISVGGAFIETKK 268

Query: 161 QIEMFSKVLFN----------DILGRVVRIFPGGIAIEFSS 191
           +  +   ++ N           +   ++R  P GIA+ F  
Sbjct: 269 RFSVGQNLVMNYPFQAIQGYIRMNAVIIRTEPDGIAVRFKE 309


>gi|15606591|ref|NP_213971.1| cellulose synthase catalytic subunit [Aquifex aeolicus VF5]
 gi|2983803|gb|AAC07360.1| cellulose synthase catalytic subunit [Aquifex aeolicus VF5]
          Length = 759

 Score = 39.8 bits (92), Expect = 0.25,   Method: Composition-based stats.
 Identities = 15/67 (22%), Positives = 29/67 (43%), Gaps = 2/67 (2%)

Query: 117 CRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGR 176
            R   RK  R    D  ++  D+     +VIDIS  G++V ++ + +   +    + +  
Sbjct: 586 ERRQRRKFHRIPSNDQIIIYRDSETLLGRVIDISLGGLAVKLETKPK--EEFKEGEEVKG 643

Query: 177 VVRIFPG 183
           V+R    
Sbjct: 644 VIRNVEN 650


>gi|157363483|ref|YP_001470250.1| type IV pilus assembly PilZ [Thermotoga lettingae TMO]
 gi|157314087|gb|ABV33186.1| type IV pilus assembly PilZ [Thermotoga lettingae TMO]
          Length = 234

 Score = 39.4 bits (91), Expect = 0.27,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 8   LQFIDQRAFQRVKVDLKGRFLLF-DGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFV 66
           ++ I +R F R+ + L G + +  D  EY+ + R+ S GG+ ++C   +  VG+   V +
Sbjct: 110 VRRIQRRCFVRIPIVLNGTYTVPGDDKEYSFLTRDFSAGGM-LMCTKNILSVGQPISVNM 168

Query: 67  E 67
           +
Sbjct: 169 D 169


>gi|288941294|ref|YP_003443534.1| type IV pilus assembly PilZ [Allochromatium vinosum DSM 180]
 gi|288896666|gb|ADC62502.1| type IV pilus assembly PilZ [Allochromatium vinosum DSM 180]
          Length = 98

 Score = 39.4 bits (91), Expect = 0.29,   Method: Composition-based stats.
 Identities = 20/98 (20%), Positives = 37/98 (37%), Gaps = 22/98 (22%)

Query: 116 DCRAYGRKITRDREVDAQLVLNDNTKHSCKVI--DISESGVSVSVDLQ---IEMFSKVLF 170
           + R + R       V+ ++ L+ + +  C V   D+S  GVS+ ++       + ++V  
Sbjct: 6   EKRQHPRLP-----VEVEVELHRSGRSMCLVWTDDLSNGGVSLMMNGHGDWPPIGARVQI 60

Query: 171 -------ND-----ILGRVVRIFPGGIAIEFSSVQESN 196
                   D     +   VVR    GIA+ F       
Sbjct: 61  RVSCPLGGDDESPLVDAIVVRHTEAGIAVRFDETPTRE 98


>gi|194291395|ref|YP_002007302.1| glycosyltransferase [Cupriavidus taiwanensis LMG 19424]
 gi|193225299|emb|CAQ71241.1| glycosyl transferase; similar to bcsA, catalytic unit (UDP-forming)
           of cellulose synthase [Cupriavidus taiwanensis LMG
           19424]
          Length = 653

 Score = 39.4 bits (91), Expect = 0.30,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 28/73 (38%), Gaps = 11/73 (15%)

Query: 114 LQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDL----QIEMFSKVL 169
           L   R   R         A L+  D  ++     D+S +GV+V+  L    +  M  ++ 
Sbjct: 533 LPRPRKEERF----PHHAAALLRVDGREYRVTTRDLSCNGVAVTTPLAPAFRPGMEGELW 588

Query: 170 F---NDILGRVVR 179
                 I  RVVR
Sbjct: 589 LAQTGWIPCRVVR 601


>gi|163849989|ref|YP_001638032.1| hypothetical protein Mext_0546 [Methylobacterium extorquens PA1]
 gi|163661594|gb|ABY28961.1| hypothetical protein Mext_0546 [Methylobacterium extorquens PA1]
          Length = 185

 Score = 39.4 bits (91), Expect = 0.31,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 4/60 (6%)

Query: 117 CRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGR 176
            R   R         A + L D T+  C V DIS+SG  + V    E+ S  +   I+GR
Sbjct: 70  ARREER---TSTNWIALIRLFDGTEIPCNVKDISKSGAKLGVPATYELPSAFMI-RIIGR 125


>gi|148547357|ref|YP_001267459.1| cellulose synthase catalytic subunit [Pseudomonas putida F1]
 gi|148511415|gb|ABQ78275.1| Cellulose synthase (UDP-forming) [Pseudomonas putida F1]
          Length = 869

 Score = 39.4 bits (91), Expect = 0.33,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVC-DVPMFLVGERS 62
           R   RV++ L    +L  G  Y C + + S GG+ +          GE+ 
Sbjct: 696 RRAHRVQMRLPAGLMLASGHAYPCTLVDYSDGGIGLQVQPGLELKPGEQV 745


>gi|26989354|ref|NP_744779.1| cellulose synthase catalytic subunit [Pseudomonas putida KT2440]
 gi|24984212|gb|AAN68243.1|AE016458_8 cellulose synthase, putative [Pseudomonas putida KT2440]
          Length = 869

 Score = 39.1 bits (90), Expect = 0.34,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVC-DVPMFLVGERS 62
           R   RV++ L    +L  G  Y C + + S GG+ +          GE+ 
Sbjct: 696 RRAHRVQMRLPAGLMLASGHAYPCTLVDYSDGGIGLQVQPGLELKPGEQV 745


>gi|58428926|gb|AAW77927.1| alginate biosynthesis protein Alg44 [Pseudomonas aeruginosa]
          Length = 272

 Score = 39.1 bits (90), Expect = 0.37,   Method: Composition-based stats.
 Identities = 11/48 (22%), Positives = 21/48 (43%)

Query: 13 QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE 60
          QR F RVK+  + R++  +    +  + ++S GG            G+
Sbjct: 6  QRQFARVKLPARIRYIGANREGVDARLLDLSAGGFAFTASGAPIQPGD 53


>gi|240137122|ref|YP_002961591.1| hypothetical protein MexAM1_META1p0366 [Methylobacterium extorquens
           AM1]
 gi|240007088|gb|ACS38314.1| hypothetical protein MexAM1_META1p0366 [Methylobacterium extorquens
           AM1]
          Length = 145

 Score = 39.1 bits (90), Expect = 0.37,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 4/60 (6%)

Query: 117 CRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGR 176
            R   R         A + L D T+  C V DIS+SG  + V    E+ S  +   I+GR
Sbjct: 30  ARREER---TSTNWIALIRLFDGTEIPCNVKDISKSGAKLGVPATYELPSAFMI-RIIGR 85


>gi|77457185|ref|YP_346690.1| alginate biosynthesis protein Alg44 [Pseudomonas fluorescens
          Pf0-1]
 gi|77381188|gb|ABA72701.1| putative alginate biosynthesis-related protein [Pseudomonas
          fluorescens Pf0-1]
          Length = 389

 Score = 39.1 bits (90), Expect = 0.38,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 26/62 (41%), Gaps = 4/62 (6%)

Query: 13 QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE----RSIVFVEK 68
          QR   RVK+  K RF   D T     V ++S GGL          VGE    R    ++ 
Sbjct: 16 QRQHARVKIPAKLRFFGPDRTPVEARVLDLSAGGLAFNAGQLPLTVGEVYKARLQFVIDN 75

Query: 69 VG 70
          +G
Sbjct: 76 LG 77


>gi|227356454|ref|ZP_03840842.1| cellulose synthase catalytic subunit [Proteus mirabilis ATCC 29906]
 gi|227163564|gb|EEI48485.1| cellulose synthase catalytic subunit [Proteus mirabilis ATCC 29906]
          Length = 865

 Score = 39.1 bits (90), Expect = 0.39,   Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 25/46 (54%)

Query: 7   NLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCD 52
           +++   +R F RV++ +    LL DG+ Y+C + + S  G  IV  
Sbjct: 689 SVEAKQERQFPRVRLRVPAMLLLQDGSLYSCQLNDFSDNGCAIVLP 734


>gi|197285946|ref|YP_002151818.1| cellulose synthase catalytic subunit [Proteus mirabilis HI4320]
 gi|194683433|emb|CAR44193.1| cellulose synthase catalytic subunit [UDP-forming] [Proteus
           mirabilis HI4320]
          Length = 865

 Score = 39.1 bits (90), Expect = 0.39,   Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 25/46 (54%)

Query: 7   NLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCD 52
           +++   +R F RV++ +    LL DG+ Y+C + + S  G  IV  
Sbjct: 689 SVEAKQERQFPRVRLRVPAMLLLQDGSLYSCQLNDFSDNGCAIVLP 734


>gi|254559134|ref|YP_003066229.1| hypothetical protein METDI0518 [Methylobacterium extorquens DM4]
 gi|254266412|emb|CAX22176.1| hypothetical protein METDI0518 [Methylobacterium extorquens DM4]
          Length = 145

 Score = 39.1 bits (90), Expect = 0.40,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 4/60 (6%)

Query: 117 CRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGR 176
            R   R         A + L D T+  C V DIS+SG  + V    E+ S  +   I+GR
Sbjct: 30  ARREER---TSTNWIALIRLFDGTEIPCNVKDISKSGAKLGVPATYELPSAFMI-RIIGR 85


>gi|218528528|ref|YP_002419344.1| hypothetical protein Mchl_0481 [Methylobacterium chloromethanicum
           CM4]
 gi|218520831|gb|ACK81416.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
          Length = 150

 Score = 39.1 bits (90), Expect = 0.42,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 4/60 (6%)

Query: 117 CRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGR 176
            R   R         A + L D T+  C V DIS+SG  + V    E+ S  +   I+GR
Sbjct: 35  ARREER---TSTNWIALIRLFDGTEIPCNVKDISKSGAKLGVPATYELPSAFMI-RIIGR 90


>gi|324113650|gb|EGC07625.1| cellulose synthase catalytic subunit [Escherichia fergusonii B253]
          Length = 701

 Score = 39.1 bits (90), Expect = 0.42,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIV 50
           R   R++V   G  LL +GT + C V + S GGL I 
Sbjct: 557 RVSPRIEVAFSGHLLLTNGTRHPCSVIDFSEGGLGIT 593



 Score = 36.4 bits (83), Expect = 2.5,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 6/65 (9%)

Query: 103 LIWLANKDD-----LHLQDCRAYGRKITRDREVDA-QLVLNDNTKHSCKVIDISESGVSV 156
           L+WL          L +   +   R   R     +  L+L + T+H C VID SE G+ +
Sbjct: 533 LMWLVYNTIIIGATLAVSIEQKQVRVSPRIEVAFSGHLLLTNGTRHPCSVIDFSEGGLGI 592

Query: 157 SVDLQ 161
           ++  +
Sbjct: 593 TLHSR 597


>gi|349068|gb|AAC36876.1| alginate synthesis-related protein [Pseudomonas aeruginosa]
 gi|740003|prf||2004288B alginate synthesis-related protein
          Length = 316

 Score = 39.1 bits (90), Expect = 0.43,   Method: Composition-based stats.
 Identities = 11/48 (22%), Positives = 21/48 (43%)

Query: 13 QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE 60
          QR F RVK+  + R++  +    +  + ++S GG            G+
Sbjct: 16 QRQFARVKLPARIRYIGANREGVDARLLDLSAGGFAFTASGAPIQPGD 63


>gi|114778691|ref|ZP_01453503.1| hypothetical protein SPV1_13487 [Mariprofundus ferrooxydans PV-1]
 gi|114551053|gb|EAU53615.1| hypothetical protein SPV1_13487 [Mariprofundus ferrooxydans PV-1]
          Length = 127

 Score = 38.7 bits (89), Expect = 0.49,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 32/94 (34%), Gaps = 12/94 (12%)

Query: 124 ITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFS----KVLFNDIL----- 174
           ++      A + L D +    ++ID++  G+ +  +      S     +    I      
Sbjct: 11  VSEGVPATASIALQDGSTLEGEIIDLAMHGMFLRSNNPPATGSSCQATIRLGHIRHELSI 70

Query: 175 ---GRVVRIFPGGIAIEFSSVQESNIAFKSLINH 205
                VV +    +A+ F SV+         I H
Sbjct: 71  EAECTVVHVVGNSVALRFDSVKLEGKGQNQHIEH 104


>gi|126739523|ref|ZP_01755216.1| hypothetical protein RSK20926_21440 [Roseobacter sp. SK209-2-6]
 gi|126719623|gb|EBA16332.1| hypothetical protein RSK20926_21440 [Roseobacter sp. SK209-2-6]
          Length = 303

 Score = 38.7 bits (89), Expect = 0.49,   Method: Composition-based stats.
 Identities = 12/69 (17%), Positives = 31/69 (44%), Gaps = 4/69 (5%)

Query: 140 TKHSCKVIDISESGVSVSVDLQIEMFSKVLFN----DILGRVVRIFPGGIAIEFSSVQES 195
           + +   ++++S SG  + +   ++   +V  N        RVVR     + ++F  +  +
Sbjct: 222 SLYPAMIVNVSRSGAKLQIARGLDSGHRVELNFLGERAPARVVRCSKDHMMLDFDEMMNT 281

Query: 196 NIAFKSLIN 204
            +  ++L N
Sbjct: 282 ELLDRALFN 290


>gi|15598738|ref|NP_252232.1| alginate biosynthesis protein Alg44 [Pseudomonas aeruginosa PAO1]
 gi|107103054|ref|ZP_01366972.1| hypothetical protein PaerPA_01004123 [Pseudomonas aeruginosa
          PACS2]
 gi|116051540|ref|YP_789623.1| alginate biosynthesis protein Alg44 [Pseudomonas aeruginosa
          UCBPP-PA14]
 gi|218890231|ref|YP_002439095.1| alginate biosynthesis protein Alg44 [Pseudomonas aeruginosa
          LESB58]
 gi|254236466|ref|ZP_04929789.1| alginate biosynthesis protein Alg44 [Pseudomonas aeruginosa
          C3719]
 gi|254242245|ref|ZP_04935567.1| alginate biosynthesis protein Alg44 [Pseudomonas aeruginosa 2192]
 gi|296387955|ref|ZP_06877430.1| alginate biosynthesis protein Alg44 [Pseudomonas aeruginosa PAb1]
 gi|313108887|ref|ZP_07794870.1| alginate biosynthesis protein Alg44 [Pseudomonas aeruginosa
          39016]
 gi|33514891|sp|Q9HY69|ALG44_PSEAE RecName: Full=Alginate biosynthesis protein Alg44
 gi|9949693|gb|AAG06930.1|AE004775_1 alginate biosynthesis protein Alg44 [Pseudomonas aeruginosa PAO1]
 gi|115586761|gb|ABJ12776.1| alginate biosynthesis protein Alg44 [Pseudomonas aeruginosa
          UCBPP-PA14]
 gi|126168397|gb|EAZ53908.1| alginate biosynthesis protein Alg44 [Pseudomonas aeruginosa
          C3719]
 gi|126195623|gb|EAZ59686.1| alginate biosynthesis protein Alg44 [Pseudomonas aeruginosa 2192]
 gi|218770454|emb|CAW26219.1| alginate biosynthesis protein Alg44 [Pseudomonas aeruginosa
          LESB58]
 gi|310881372|gb|EFQ39966.1| alginate biosynthesis protein Alg44 [Pseudomonas aeruginosa
          39016]
          Length = 389

 Score = 38.7 bits (89), Expect = 0.50,   Method: Composition-based stats.
 Identities = 11/48 (22%), Positives = 21/48 (43%)

Query: 13 QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE 60
          QR F RVK+  + R++  +    +  + ++S GG            G+
Sbjct: 16 QRQFARVKLPARIRYIGANREGVDARLLDLSAGGFAFTASGAPIQPGD 63


>gi|152987431|ref|YP_001346987.1| alginate biosynthesis protein Alg44 [Pseudomonas aeruginosa PA7]
 gi|150962589|gb|ABR84614.1| alginate biosynthesis protein Alg44 [Pseudomonas aeruginosa PA7]
          Length = 389

 Score = 38.7 bits (89), Expect = 0.52,   Method: Composition-based stats.
 Identities = 11/48 (22%), Positives = 21/48 (43%)

Query: 13 QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE 60
          QR F RVK+  + R++  +    +  + ++S GG            G+
Sbjct: 16 QRQFARVKLPARIRYIGANREGVDARLLDLSAGGFAFTASGAPIQPGD 63


>gi|126728311|ref|ZP_01744127.1| hypothetical protein SSE37_20012 [Sagittula stellata E-37]
 gi|126711276|gb|EBA10326.1| hypothetical protein SSE37_20012 [Sagittula stellata E-37]
          Length = 96

 Score = 38.7 bits (89), Expect = 0.52,   Method: Composition-based stats.
 Identities = 16/64 (25%), Positives = 30/64 (46%), Gaps = 5/64 (7%)

Query: 133 QLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDIL----GRVVRIFPGGIAIE 188
           +L   D    +  ++++SE+G      L + + S+V    +       VVRI P G+A+ 
Sbjct: 16  ELRSEDG-DFAATIVNVSETGAFAEGSLPLAVGSRVKLMAMRQPVYASVVRISPRGVALS 74

Query: 189 FSSV 192
           F + 
Sbjct: 75  FETP 78


>gi|94263265|ref|ZP_01287081.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93456348|gb|EAT06472.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
          Length = 124

 Score = 38.7 bits (89), Expect = 0.55,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 39/92 (42%), Gaps = 16/92 (17%)

Query: 114 LQDCRAYGRKITRDREVDAQLVLNDNTK-HSCKVIDISESGVSV------------SVDL 160
           + + R   R      +    L   D    H C+  D+S +GVSV            +++L
Sbjct: 3   VNERRQSSRVP---FKATISLRFADERHYHRCQTADLSLTGVSVPGVYGHQVGEKCAIEL 59

Query: 161 QIEMFSKVLFNDILGRVVRIFPGGIAIEFSSV 192
            +   S  L  ++ G V+R    G+A+ F+++
Sbjct: 60  FLSGGSSDLRLEMQGEVIRAGDDGLALHFTAI 91


>gi|229588530|ref|YP_002870649.1| putative alginate biosynthesis-like protein [Pseudomonas
          fluorescens SBW25]
 gi|229360396|emb|CAY47253.1| putative alginate biosynthesis-related protein [Pseudomonas
          fluorescens SBW25]
          Length = 388

 Score = 38.7 bits (89), Expect = 0.56,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 35/86 (40%), Gaps = 11/86 (12%)

Query: 13 QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRI 72
          QR   RVK+  K RF   D T+    V ++S GGL      P+  +GE         GR+
Sbjct: 16 QRQHARVKIPAKLRFFNTDRTQTEARVIDLSAGGLAFTATQPL-TIGEV------HKGRL 68

Query: 73 EGKVVNFDSNRGYAVRIVTSENERRK 98
          +  +     N G A+ +        +
Sbjct: 69 QFVI----DNLGLAMDVELQIRSYDR 90


>gi|73537356|ref|YP_297723.1| cellulose synthase (UDP-forming) [Ralstonia eutropha JMP134]
 gi|72120693|gb|AAZ62879.1| Cellulose synthase (UDP-forming) [Ralstonia eutropha JMP134]
          Length = 855

 Score = 38.7 bits (89), Expect = 0.56,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFL-VGERS 62
           R   R+ + +    LL DG    C     S GGL ++  V   +  GE+ 
Sbjct: 705 RISHRIPMRVPATLLLPDGRTLACRTENYSLGGLGLMLPVETRVDPGEQV 754


>gi|94272431|ref|ZP_01292122.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93450133|gb|EAT01465.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
          Length = 124

 Score = 38.3 bits (88), Expect = 0.60,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 39/92 (42%), Gaps = 16/92 (17%)

Query: 114 LQDCRAYGRKITRDREVDAQLVLNDNTK-HSCKVIDISESGVSV----------SVDLQI 162
           + + R   R      +    L   D    H C+  D+S +GVSV            D+++
Sbjct: 3   VNERRQSSRVP---FKATISLRFADERHYHRCQTADLSLTGVSVPGVYGHQVGEKCDIEL 59

Query: 163 EM--FSKVLFNDILGRVVRIFPGGIAIEFSSV 192
            +   S  L  ++ G V+R    G+A+ F+++
Sbjct: 60  FLSGGSSDLRLEMQGEVIRAGDDGLALHFTAI 91


>gi|94271446|ref|ZP_01291959.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93450443|gb|EAT01629.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
          Length = 124

 Score = 38.3 bits (88), Expect = 0.62,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 39/92 (42%), Gaps = 16/92 (17%)

Query: 114 LQDCRAYGRKITRDREVDAQLVLNDNTK-HSCKVIDISESGVSV----------SVDLQI 162
           + + R   R      +    L   D    H C+  D+S +GVSV            D+++
Sbjct: 3   VNERRQSSRVP---FKATISLRFADERHYHRCQTADLSLTGVSVPGVYGHQVGEKCDIEL 59

Query: 163 EM--FSKVLFNDILGRVVRIFPGGIAIEFSSV 192
            +   S  L  ++ G V+R    G+A+ F+++
Sbjct: 60  FLSGGSSDLRLEMRGEVIRAGDDGLALHFTAI 91


>gi|325496948|gb|EGC94807.1| cellulose synthase catalytic subunit [Escherichia fergusonii
           ECD227]
          Length = 701

 Score = 38.3 bits (88), Expect = 0.70,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIV 50
           R   R++V   G  LL +GT + C + + S GGL I 
Sbjct: 557 RVSPRIEVAFSGHLLLTNGTRHPCSIIDFSEGGLGIT 593



 Score = 36.4 bits (83), Expect = 2.7,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 27/61 (44%), Gaps = 6/61 (9%)

Query: 103 LIWLANKDD-----LHLQDCRAYGRKITRDREVDA-QLVLNDNTKHSCKVIDISESGVSV 156
           L+WL          L +   +   R   R     +  L+L + T+H C +ID SE G+ +
Sbjct: 533 LMWLVYNTIIIGATLAVSIEQKQVRVSPRIEVAFSGHLLLTNGTRHPCSIIDFSEGGLGI 592

Query: 157 S 157
           +
Sbjct: 593 T 593


>gi|148264011|ref|YP_001230717.1| type IV pilus assembly PilZ [Geobacter uraniireducens Rf4]
 gi|146397511|gb|ABQ26144.1| type IV pilus assembly PilZ [Geobacter uraniireducens Rf4]
          Length = 93

 Score = 38.3 bits (88), Expect = 0.71,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 15/87 (17%)

Query: 114 LQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFN-- 171
           L + R + R        DA +  +D T     V ++S  GV V+   +I +   V     
Sbjct: 5   LMERRKFARLA---LHSDASIKHDD-TVIMGVVENLSMKGVFVNTTEKIPLNDSVEVTIY 60

Query: 172 ---------DILGRVVRIFPGGIAIEF 189
                    D+   VVR+   GI +EF
Sbjct: 61  TYSTPDQLCDLQATVVRVTETGIGLEF 87


>gi|226943228|ref|YP_002798301.1| alginate biosynthesis protein Alg44 [Azotobacter vinelandii DJ]
 gi|226718155|gb|ACO77326.1| alginate biosynthesis protein Alg44 [Azotobacter vinelandii DJ]
          Length = 388

 Score = 37.9 bits (87), Expect = 0.78,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 33/79 (41%), Gaps = 7/79 (8%)

Query: 13 QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE----RSIVFVEK 68
          QR   RVK+  K RFL  +       + +IS GG       P+   G     + +  ++ 
Sbjct: 17 QRQHARVKLPGKIRFLGPNRETIEQRLIDISAGGFSFASGKPVTQQGAFHRGKLLFQLDS 76

Query: 69 VG---RIEGKVVNFDSNRG 84
          +G    +E +V N D   G
Sbjct: 77 LGLAMDVEFQVRNLDPESG 95


>gi|163795195|ref|ZP_02189163.1| hypothetical protein BAL199_05989 [alpha proteobacterium BAL199]
 gi|159179593|gb|EDP64122.1| hypothetical protein BAL199_05989 [alpha proteobacterium BAL199]
          Length = 121

 Score = 37.9 bits (87), Expect = 0.82,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 29/82 (35%), Gaps = 10/82 (12%)

Query: 116 DCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFN---- 171
           + R Y R               D     C++ ++S  GV ++  + + M + V       
Sbjct: 16  ERRRYPRYPASAPLEIDV----DGATMECRLDNVSAGGVRLTPAVTVHMGAMVTVRHSSS 71

Query: 172 --DILGRVVRIFPGGIAIEFSS 191
              + GRVV        ++F S
Sbjct: 72  GLALQGRVVGQDDESTRVQFDS 93


>gi|162451020|ref|YP_001613387.1| hypothetical protein sce2748 [Sorangium cellulosum 'So ce 56']
 gi|161161602|emb|CAN92907.1| hypothetical protein predicted by Glimmer/Critica [Sorangium
           cellulosum 'So ce 56']
          Length = 769

 Score = 37.9 bits (87), Expect = 0.83,   Method: Composition-based stats.
 Identities = 16/79 (20%), Positives = 32/79 (40%), Gaps = 7/79 (8%)

Query: 17  QRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGR---IE 73
           QRV+V+         G  +     ++SP G+ +     +  VG+  I   + +G+   +E
Sbjct: 34  QRVRVEALVAVGETSGGGFEAESIDMSPEGMRLRTA-YLPRVGDALICRFDGLGKELVVE 92

Query: 74  GKV---VNFDSNRGYAVRI 89
           G+V           + +R 
Sbjct: 93  GEVCWRTEQARGGEFGLRF 111


>gi|298504420|gb|ADI83143.1| PilZ domain protein [Geobacter sulfurreducens KN400]
          Length = 119

 Score = 37.9 bits (87), Expect = 0.86,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 36/96 (37%), Gaps = 16/96 (16%)

Query: 116 DCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFN---- 171
           + R + R           ++ ++ T    +V ++S  G+ V  D +I +  +V  +    
Sbjct: 2   EKRKFERI----DFRSEAIIRHNGTSFRAEVENVSLKGLFVRTDQKIPINEQVDVSMFFF 57

Query: 172 --------DILGRVVRIFPGGIAIEFSSVQESNIAF 199
                    +   VVRI   GI + F  +   ++  
Sbjct: 58  GSSAELSFSLEASVVRITDDGIGLNFRKIDMDSLVH 93


>gi|188579785|ref|YP_001923230.1| hypothetical protein Mpop_0517 [Methylobacterium populi BJ001]
 gi|179343283|gb|ACB78695.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 144

 Score = 37.9 bits (87), Expect = 0.96,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 26/65 (40%), Gaps = 7/65 (10%)

Query: 99  LADKLIWLANKDDLHLQDC----RAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGV 154
           LAD L  LA  D     +     R   R         A + L D T+  C V DIS+SG 
Sbjct: 11  LADLLPELAAGDASANHEDPLVARREER---TSTNWIALIRLFDGTEIPCNVKDISKSGA 67

Query: 155 SVSVD 159
            + V 
Sbjct: 68  KLGVP 72


>gi|317131839|ref|YP_004091153.1| glycosyl transferase family 2 [Ethanoligenens harbinense YUAN-3]
 gi|315469818|gb|ADU26422.1| glycosyl transferase family 2 [Ethanoligenens harbinense YUAN-3]
          Length = 668

 Score = 37.9 bits (87), Expect = 0.97,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 34/93 (36%), Gaps = 15/93 (16%)

Query: 120 YGRKITRDREVDAQLVLNDNTKHS--CKVIDISESGVSVSVDL-------QIEMFSKVLF 170
           + R   R     A L+          C ++D+SE+GV +  D        ++++      
Sbjct: 540 HLRATERIPGRAAVLLRAAGRTEPISCSLLDLSETGVRLECDTVNLQKSDRVQIDFPYAT 599

Query: 171 NDILGRVVR-----IFPGGIAIEFSSVQESNIA 198
             +   VVR          +A+ F+ + E   A
Sbjct: 600 G-VRATVVRRKVWENRSDEMALRFTELSEKQYA 631


>gi|300022027|ref|YP_003754638.1| glycosyl transferase family 2 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523848|gb|ADJ22317.1| glycosyl transferase family 2 [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 656

 Score = 37.5 bits (86), Expect = 0.98,   Method: Composition-based stats.
 Identities = 18/97 (18%), Positives = 40/97 (41%), Gaps = 11/97 (11%)

Query: 115 QDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFN--- 171
           Q  R   R    D  V  +L + +  +      D+S SG+ +  DL + + + V  +   
Sbjct: 541 QQRRTGDRF---DVRVPVKLTV-NGEQRDYFASDLSVSGMHLIGDLPVPVGTPVKISFAD 596

Query: 172 -DILGRVVRIFPGGIAIEFSSVQESNIAFKSLINHCY 207
             +   + R    G  ++F   + ++ A  S++ + +
Sbjct: 597 ISLEAHIRRTTQTGFGLQF---EATDKAKMSVLRYIF 630


>gi|114776986|ref|ZP_01452006.1| hypothetical protein SPV1_06479 [Mariprofundus ferrooxydans PV-1]
 gi|114552507|gb|EAU54967.1| hypothetical protein SPV1_06479 [Mariprofundus ferrooxydans PV-1]
          Length = 143

 Score = 37.5 bits (86), Expect = 0.99,   Method: Composition-based stats.
 Identities = 25/119 (21%), Positives = 41/119 (34%), Gaps = 12/119 (10%)

Query: 99  LADKLIWLANKDDLHLQDC-RAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVS 157
           LA++L     +  L L    R   R+  R+   +     +    H     DIS +GV V 
Sbjct: 15  LAERLPEEKERQLLSLIASWREDVRRSPRESYNELLHFSSSKGAHYGHARDISGTGVFVE 74

Query: 158 VDLQIEMFSKVLFN----------DILGRVVRIFPGGIAIEFSSV-QESNIAFKSLINH 205
                E+  +V              + G VVR    G+ + F    Q+       +I+ 
Sbjct: 75  TLADFELGEQVSLELTFISAPNPVRLTGEVVRKEEDGVGLRFDQQSQDQVAKLDDIISQ 133


>gi|33514696|sp|P94200|ALG44_AZOVI RecName: Full=Alginate biosynthesis protein Alg44
 gi|1944520|emb|CAA70054.1| Alg44 protein [Azotobacter vinelandii]
          Length = 389

 Score = 37.5 bits (86), Expect = 1.1,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 33/79 (41%), Gaps = 7/79 (8%)

Query: 13 QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE----RSIVFVEK 68
          QR   RVK+  K RFL  +       + +IS GG       P+   G     + +  ++ 
Sbjct: 17 QRQHARVKLPGKIRFLGPNRETIEQRLIDISAGGFSFASGKPVTQQGAFHRGKLLFQLDS 76

Query: 69 VG---RIEGKVVNFDSNRG 84
          +G    +E +V N D   G
Sbjct: 77 LGLAMDVEFQVRNLDPESG 95


>gi|119896936|ref|YP_932149.1| hypothetical protein azo0645 [Azoarcus sp. BH72]
 gi|119669349|emb|CAL93262.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 120

 Score = 37.5 bits (86), Expect = 1.2,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 7/79 (8%)

Query: 11 IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVP--MFLVGERSIVFV-- 66
          ++ R F R++       LL DG E  C V ++S  G  I    P  +   GER ++ +  
Sbjct: 3  VEHRHFSRIRFQTGAH-LLIDGREIACEVCDLSLKGALIEAPDPATLPPPGERCLLELQL 61

Query: 67 --EKVGRIEGKVVNFDSNR 83
            + + R+EG V + +  R
Sbjct: 62 DSDALVRMEGDVAHVEGRR 80


>gi|124515765|gb|EAY57274.1| Cellulose synthase catalytic subunit (UDP-forming) [Leptospirillum
           rubarum]
 gi|206602270|gb|EDZ38752.1| Cellulose synthase catalytic subunit (UDP- forming) [Leptospirillum
           sp. Group II '5-way CG']
          Length = 714

 Score = 37.5 bits (86), Expect = 1.3,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 35/86 (40%), Gaps = 8/86 (9%)

Query: 13  QRAFQ-RVKVDLKGRFLLFDGTEYNCIVREISPGGLCI-VCDVPMFLVGERS---IVFVE 67
           QR F+ R+ V+   R    DG        ++S  G+ I +        GE     I F++
Sbjct: 559 QRRFRPRINVNYPVRLSAPDGQYVYGETEDMSDDGVRIRLLKSASLRTGEDVRVEIPFLD 618

Query: 68  KVGRIEGKVVNFDSNRGYAVRIVTSE 93
           ++     ++V  D    +++R+    
Sbjct: 619 RIHEFPAEIVGMDE---FSIRLNFHP 641


>gi|330811548|ref|YP_004356010.1| alginate biosynthesis protein Alg44 [Pseudomonas brassicacearum
          subsp. brassicacearum NFM421]
 gi|327379656|gb|AEA71006.1| Putative alginate biosynthesis protein Alg44 [Pseudomonas
          brassicacearum subsp. brassicacearum NFM421]
          Length = 389

 Score = 37.5 bits (86), Expect = 1.3,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 31/86 (36%), Gaps = 10/86 (11%)

Query: 13 QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRI 72
          QR   RVK+  K RF   D T     V ++S GGL           GE         GR+
Sbjct: 16 QRQHARVKIPAKLRFFGPDRTPMEVKVLDLSAGGLSFNAGQMPLKTGE------SYKGRL 69

Query: 73 EGKVVNFDSNRGYAVRIVTSENERRK 98
          +  +     N G A+ +        +
Sbjct: 70 QFVI----DNLGLAMDVELQIRSYDR 91


>gi|170744172|ref|YP_001772827.1| methyl-accepting chemotaxis sensory transducer [Methylobacterium
           sp. 4-46]
 gi|168198446|gb|ACA20393.1| methyl-accepting chemotaxis sensory transducer [Methylobacterium
           sp. 4-46]
          Length = 713

 Score = 37.1 bits (85), Expect = 1.3,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 36/105 (34%), Gaps = 7/105 (6%)

Query: 5   IHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV 64
           +      D R   RV       F   +G   +    E+S GG  I         G    +
Sbjct: 439 VRAFSATDNRRAPRVPARWPASFEAPEGRA-SLRTIEVSEGGFLIDAPPFATEAGREGTL 497

Query: 65  FVEKVGRIEGKVVNFDSNRGYAVRIVTSE-----NERRKLADKLI 104
            +  +GR   +V   +   G  ++I  SE       R ++A  L+
Sbjct: 498 DLAGIGRFAVEVA-GEQPLGTRLKIRPSEPEAMDRLRERIAAILV 541


>gi|227328206|ref|ZP_03832230.1| cellulose synthase catalytic subunit [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 899

 Score = 37.1 bits (85), Expect = 1.6,   Method: Composition-based stats.
 Identities = 20/109 (18%), Positives = 45/109 (41%), Gaps = 13/109 (11%)

Query: 7   NLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVC-DVPMFLVGERSIVF 65
            ++    R   RV++ +    L  DG  + C++R+ S GG+ +   +  +  VG+   + 
Sbjct: 689 AVEAKQVRQAHRVEMSMSAAILRADGHLFPCVLRDYSDGGVGVEARESGILQVGDSVSLL 748

Query: 66  VEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHL 114
           +++ G+ E           YA     +     K+  ++  LA +  +  
Sbjct: 749 LKR-GQQE-----------YAFPFSVTRAFDNKIGLRMTNLAIRQHIDF 785


>gi|168260643|ref|ZP_02682616.1| cellulose synthase [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|205350332|gb|EDZ36963.1| cellulose synthase [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
          Length = 874

 Score = 37.1 bits (85), Expect = 1.6,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 6/75 (8%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDV-PMFLVGERSIVFVEKVGRI 72
           R   RV++ + G     DG  ++C V + S GGL I  +     L G++  + ++  G+ 
Sbjct: 696 RRAHRVEIAMPGAIAREDGHLFSCTVHDFSDGGLGIKINGQAQVLEGQKVNLLLKH-GQQ 754

Query: 73  E----GKVVNFDSNR 83
           E     +VV    N 
Sbjct: 755 EYVFPTQVVRVTGNE 769


>gi|94311194|ref|YP_584404.1| glycosyl transferase family protein [Cupriavidus metallidurans
           CH34]
 gi|93355046|gb|ABF09135.1| cellulose synthase, catalytic subunit [Cupriavidus metallidurans
           CH34]
          Length = 857

 Score = 37.1 bits (85), Expect = 1.6,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 20/45 (44%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLV 58
           R   R+ + +    LL DG    C     S GGL +V  + + LV
Sbjct: 707 RVSHRIPMRVPATLLLPDGRTIACKTENYSMGGLGMVLPIDVPLV 751


>gi|312959097|ref|ZP_07773616.1| alginate biosynthesis protein Alg44 [Pseudomonas fluorescens WH6]
 gi|311286867|gb|EFQ65429.1| alginate biosynthesis protein Alg44 [Pseudomonas fluorescens WH6]
          Length = 388

 Score = 37.1 bits (85), Expect = 1.7,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 13/87 (14%)

Query: 13 QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRI 72
          QR   RVK+  K RF   D T     V ++S GGL      P+             VG++
Sbjct: 16 QRQHARVKIPAKLRFFNSDRTPTEARVIDLSAGGLAFTATQPLT------------VGQV 63

Query: 73 -EGKVVNFDSNRGYAVRIVTSENERRK 98
           +G++     N G A+ +        +
Sbjct: 64 HKGRLQFVIDNLGLAMDVELQIRSYDR 90


>gi|307295466|ref|ZP_07575302.1| type IV pilus assembly PilZ [Sphingobium chlorophenolicum L-1]
 gi|306878505|gb|EFN09725.1| type IV pilus assembly PilZ [Sphingobium chlorophenolicum L-1]
          Length = 114

 Score = 36.8 bits (84), Expect = 1.7,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 31/94 (32%), Gaps = 10/94 (10%)

Query: 101 DKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDL 160
             L  L    D  +   R     +     V AQ        H  ++I+IS  G+    + 
Sbjct: 3   ASLAHLNRSPDPAVNQRRVQRDLVDMVSHVTAQ-----GRSHGVRIINISALGLMCRTEA 57

Query: 161 QIEMFSKVLFN----DILGRVVRIFPGG-IAIEF 189
           Q+ +  +V             VR    G I +EF
Sbjct: 58  QLAIGERVTVWLPVVKEQAGEVRWAEEGRIGVEF 91


>gi|323495677|ref|ZP_08100747.1| hypothetical protein VISI1226_04754 [Vibrio sinaloensis DSM 21326]
 gi|323319144|gb|EGA72085.1| hypothetical protein VISI1226_04754 [Vibrio sinaloensis DSM 21326]
          Length = 245

 Score = 36.8 bits (84), Expect = 1.8,   Method: Composition-based stats.
 Identities = 24/165 (14%), Positives = 52/165 (31%), Gaps = 13/165 (7%)

Query: 30  FDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDS-NRGYAVR 88
             G  + C    I      I+      +  +    + ++       V        G  + 
Sbjct: 47  PVGRTFRCKTAFIGTHSDSIILAELPKISDDDLAFYFQE--GFWATVRAISPRGEGAIIH 104

Query: 89  IVTSENERRKLADKLIWLANKDDLHLQDCRAYGRK-ITRDREVDAQLVLNDNTKHSCKVI 147
             T      K    ++ L+   D+ +   R   R  +  + +   +       K  C++ 
Sbjct: 105 FRTQLQHIVKEPLPIVMLSIPKDMQVSQLRKEPRFDVNLNAKATTET-----RKLDCEIR 159

Query: 148 DISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSV 192
           D+S+SG      +   +       + +  VV+I   G  I+F  +
Sbjct: 160 DLSKSGCRF---IAPPLSRPFQVGEEVALVVQIH-NGKQIQFEPL 200


>gi|56460180|ref|YP_155461.1| glycosyltransferase [Idiomarina loihiensis L2TR]
 gi|56179190|gb|AAV81912.1| Predicted glycosyltransferase [Idiomarina loihiensis L2TR]
          Length = 637

 Score = 36.8 bits (84), Expect = 1.8,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 25/60 (41%), Gaps = 3/60 (5%)

Query: 13  QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVG---ERSIVFVEKV 69
           QR  QR+ +       L DG E++ +  +IS  GL +       L G    R  V+   +
Sbjct: 141 QRCEQRINLVSAVTMELADGQEFSAMTVDISNNGLQLKLGFDPQLTGLKYARVKVYFSGL 200


>gi|103486870|ref|YP_616431.1| type IV pilus assembly PilZ [Sphingopyxis alaskensis RB2256]
 gi|98976947|gb|ABF53098.1| type IV pilus assembly PilZ [Sphingopyxis alaskensis RB2256]
          Length = 217

 Score = 36.8 bits (84), Expect = 1.8,   Method: Composition-based stats.
 Identities = 38/152 (25%), Positives = 63/152 (41%), Gaps = 18/152 (11%)

Query: 38  IVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERR 97
            VR +S  G+ +  DVP+  VGE   + +     + G VV  D  R   V+  T+ +   
Sbjct: 56  RVRNMSDRGMMLAADVPI-TVGEALEIALSDTVTLRGAVVWSDGGRC-GVQFDTAVD--- 110

Query: 98  KLADKLIWLANKDDLHLQDCRAYGRKITRDR-EVDAQLVLNDNTKHSCKVIDISESGVSV 156
            +AD L  LA        + RA G +  R      A++V +D T    +++D+S+ G   
Sbjct: 111 -VADILKQLAA-------EQRAMGYRQPRLPVHTQAEVVADDGTAMRIELVDLSQHGAGF 162

Query: 157 SVDLQIEMFSKVLF----NDILGRVVRIFPGG 184
             D   E+  ++            +VR    G
Sbjct: 163 VHDGHFEVGRELDIVLASGVRRRAIVRWSREG 194


>gi|293393852|ref|ZP_06638159.1| cellulose synthase catalytic subunit [Serratia odorifera DSM 4582]
 gi|291423679|gb|EFE96901.1| cellulose synthase catalytic subunit [Serratia odorifera DSM 4582]
          Length = 867

 Score = 36.8 bits (84), Expect = 2.0,   Method: Composition-based stats.
 Identities = 22/122 (18%), Positives = 46/122 (37%), Gaps = 13/122 (10%)

Query: 7   NLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVP-MFLVGERSIVF 65
            ++    R   RV++ L       DG  + C +R+ S GG+ +   V   +  G+R  + 
Sbjct: 687 AVEAKQVRQSHRVEIALPAALARADGHLFPCTLRDYSDGGVGVEMRVADQWQEGDRVALL 746

Query: 66  VEKVGRIE----GKVVNFDSNR-GYAVRIVTSENERR----KLADKLIWLANKDDLHLQD 116
           +++ G+ E     +V      + G  +  +T+           A    W   +D     +
Sbjct: 747 LKR-GQQEYSFPCQVTRAFGAKVGLRMVDMTTRQHIDFIQCTFARADTWALWQD--GFPE 803

Query: 117 CR 118
            +
Sbjct: 804 DK 805


>gi|253686484|ref|YP_003015674.1| cellulose synthase catalytic subunit (UDP-forming) [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251753062|gb|ACT11138.1| cellulose synthase catalytic subunit (UDP-forming) [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 899

 Score = 36.8 bits (84), Expect = 2.0,   Method: Composition-based stats.
 Identities = 14/61 (22%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 7   NLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVC-DVPMFLVGERSIVF 65
            ++    R   RV++ +    L  DG  + C++R+ S GG+ I   +  +  VG+   + 
Sbjct: 689 AVEAKQVRQAHRVEMSMSAAILRPDGHLFPCVLRDYSDGGVGIETRESGILQVGDSVSLL 748

Query: 66  V 66
           +
Sbjct: 749 L 749


>gi|39996294|ref|NP_952245.1| hypothetical protein GSU1192 [Geobacter sulfurreducens PCA]
 gi|39983174|gb|AAR34568.1| conserved hypothetical protein [Geobacter sulfurreducens PCA]
 gi|298505304|gb|ADI84027.1| PilZ domain protein [Geobacter sulfurreducens KN400]
          Length = 124

 Score = 36.8 bits (84), Expect = 2.0,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 37/91 (40%), Gaps = 17/91 (18%)

Query: 116 DCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVD-LQIEMFSKVLFN--- 171
           D R + R         + +V +  +  + +V D+S +G+ V     +  +  +V      
Sbjct: 2   DKRRFTRV----PFAISAMVTHGESSFTGEVADLSLNGMFVKTGGEKPAIGEEVEVVISL 57

Query: 172 ---------DILGRVVRIFPGGIAIEFSSVQ 193
                    ++ G VVR    G+A+ FS ++
Sbjct: 58  SEGEPSLNVELAGEVVRADANGVALRFSRIE 88


>gi|301611356|ref|XP_002935205.1| PREDICTED: myomesin-1 [Xenopus (Silurana) tropicalis]
          Length = 1328

 Score = 36.4 bits (83), Expect = 2.3,   Method: Composition-based stats.
 Identities = 11/73 (15%), Positives = 28/73 (38%), Gaps = 4/73 (5%)

Query: 124 ITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFS--KVLFNDILGRV--VR 179
           I       A   L +   ++ +VI +++ G S   ++   + +  ++      GR+   R
Sbjct: 403 IPVRSPRYAVFDLAEGKSYNFRVISVNKHGASEPSEITPPIQAQERLAVPSAPGRIQASR 462

Query: 180 IFPGGIAIEFSSV 192
                + ++F   
Sbjct: 463 NTRSSVVVQFDKP 475


>gi|197246934|gb|AAI69171.1| Unknown (protein for IMAGE:7854901) [Xenopus (Silurana) tropicalis]
          Length = 1313

 Score = 36.4 bits (83), Expect = 2.3,   Method: Composition-based stats.
 Identities = 11/73 (15%), Positives = 28/73 (38%), Gaps = 4/73 (5%)

Query: 124 ITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFS--KVLFNDILGRV--VR 179
           I       A   L +   ++ +VI +++ G S   ++   + +  ++      GR+   R
Sbjct: 390 IPVRSPRYAVFDLAEGKSYNFRVISVNKHGASEPSEITPPIQAQERLAVPSAPGRIQASR 449

Query: 180 IFPGGIAIEFSSV 192
                + ++F   
Sbjct: 450 NTRSSVVVQFDKP 462


>gi|225165715|ref|ZP_03727513.1| hypothetical protein ObacDRAFT_5987 [Opitutaceae bacterium TAV2]
 gi|224800049|gb|EEG18480.1| hypothetical protein ObacDRAFT_5987 [Opitutaceae bacterium TAV2]
          Length = 600

 Score = 36.4 bits (83), Expect = 2.3,   Method: Composition-based stats.
 Identities = 30/118 (25%), Positives = 44/118 (37%), Gaps = 19/118 (16%)

Query: 19  VKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFV-----EKVGRIE 73
             V   G   +  G EY  I    S G + +       +VG+R+ V +     + V +IE
Sbjct: 241 FNVISVGAMTITAGGEYGSITSFSSRGPVNVFNPNTRAIVGQRAAVHIVAPGDDIVVKIE 300

Query: 74  GKVVNFDSNRGYA-------VRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKI 124
           G  V +     +A       V ++ S   R  LADK  W A K      +     R I
Sbjct: 301 GSSVFYGDGTSFAAPIVAGGVALMAS-ASRD-LADKDTWSAQKA-----EDARDSRVI 351


>gi|94497470|ref|ZP_01304040.1| hypothetical protein SKA58_07945 [Sphingomonas sp. SKA58]
 gi|94423101|gb|EAT08132.1| hypothetical protein SKA58_07945 [Sphingomonas sp. SKA58]
          Length = 122

 Score = 36.4 bits (83), Expect = 2.3,   Method: Composition-based stats.
 Identities = 15/93 (16%), Positives = 32/93 (34%), Gaps = 7/93 (7%)

Query: 117 CRAYGRKITRDR-EVDAQLVLNDNTKH-SCKVIDISESGVSVSVDLQIEMFSKVL----- 169
            R   R   RD   +       D       ++ ++S +G+    ++ +    KV+     
Sbjct: 9   DRGPARSSPRDSLFLMTSFFAPDGRSLGRARIRNLSATGLMADCEMPLAAGQKVVLDLRG 68

Query: 170 FNDILGRVVRIFPGGIAIEFSSVQESNIAFKSL 202
              I G +       + + F  V +  +A K +
Sbjct: 69  VGRITGNIAWSRDNKVGLAFDDVIDPQLARKPV 101


>gi|218548531|ref|YP_002382322.1| cellulose synthase catalytic subunit [Escherichia fergusonii ATCC
           35469]
 gi|218356072|emb|CAQ88689.1| cellulose synthase catalytic subunit [UDP-forming] [Escherichia
           fergusonii ATCC 35469]
          Length = 701

 Score = 36.4 bits (83), Expect = 2.3,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIV 50
           R   R++V   G  LL +GT + C V + S GGL I 
Sbjct: 557 RVSPRIEVAFSGHLLLTNGTRHTCSVIDFSEGGLGIT 593



 Score = 35.2 bits (80), Expect = 5.3,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 6/65 (9%)

Query: 103 LIWLANKDD-----LHLQDCRAYGRKITRDREVDA-QLVLNDNTKHSCKVIDISESGVSV 156
           L+WL          L +   +   R   R     +  L+L + T+H+C VID SE G+ +
Sbjct: 533 LMWLVYNTIIIGATLAVSIEQKQVRVSPRIEVAFSGHLLLTNGTRHTCSVIDFSEGGLGI 592

Query: 157 SVDLQ 161
           ++  +
Sbjct: 593 TLHSR 597


>gi|118581237|ref|YP_902487.1| type IV pilus assembly PilZ [Pelobacter propionicus DSM 2379]
 gi|118503947|gb|ABL00430.1| type IV pilus assembly PilZ [Pelobacter propionicus DSM 2379]
          Length = 92

 Score = 36.4 bits (83), Expect = 2.5,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 14/82 (17%)

Query: 122 RKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDL----QIEMFSK---------- 167
           R+ TR    D  L++ D   ++CK+ +IS SGV V  D     QI +  +          
Sbjct: 6   RRGTRVACNDRCLLVFDGNSYTCKLENISISGVLVQCDESFPSQIHLGDRCGLMLCSDPK 65

Query: 168 VLFNDILGRVVRIFPGGIAIEF 189
           V       RV R+    +A++F
Sbjct: 66  VCPGQYPARVARLDASKVALQF 87


>gi|315453180|ref|YP_004073450.1| riboflavin synthase alpha chain [Helicobacter felis ATCC 49179]
 gi|315132232|emb|CBY82860.1| riboflavin synthase alpha chain [Helicobacter felis ATCC 49179]
          Length = 205

 Score = 36.4 bits (83), Expect = 2.6,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 26/48 (54%)

Query: 156 VSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSLI 203
           +  D + ++   +  N     V+R+F GG A+E S+  + +IA ++ +
Sbjct: 22  ILSDYRPKLGDSIAVNGACLTVIRLFKGGFALELSAHTQKSIALENYV 69


>gi|326388847|ref|ZP_08210429.1| hypothetical protein Y88_3591 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326206447|gb|EGD57282.1| hypothetical protein Y88_3591 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 110

 Score = 36.4 bits (83), Expect = 2.6,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 27/66 (40%), Gaps = 1/66 (1%)

Query: 19 VKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVN 78
          ++++L  R +L  G  + C + ++S  G CI        +G   ++ V  +      V  
Sbjct: 1  MRLNLPARIVLITGH-FPCQLIDMSQTGACICVPGIPPAIGASVVLEVNGIEAFGTVVWR 59

Query: 79 FDSNRG 84
            S  G
Sbjct: 60 RASQFG 65



 Score = 36.0 bits (82), Expect = 3.5,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 29/65 (44%), Gaps = 6/65 (9%)

Query: 132 AQLVLNDNTKHSCKVIDISESGVSVSVD-LQIEMFSKVLFN----DILGRVVRIFPGGIA 186
           A++VL       C++ID+S++G  + V  +   + + V+      +  G VV        
Sbjct: 7   ARIVLITG-HFPCQLIDMSQTGACICVPGIPPAIGASVVLEVNGIEAFGTVVWRRASQFG 65

Query: 187 IEFSS 191
           ++F  
Sbjct: 66  VKFDE 70


>gi|91978299|ref|YP_570958.1| Cache, type 2 [Rhodopseudomonas palustris BisB5]
 gi|91684755|gb|ABE41057.1| Cache, type 2 [Rhodopseudomonas palustris BisB5]
          Length = 661

 Score = 36.4 bits (83), Expect = 2.7,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 37/84 (44%), Gaps = 3/84 (3%)

Query: 11  IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKV- 69
           +D+RA  R+ ++  G      G  Y   VR+IS  G  +   +          + ++ + 
Sbjct: 564 VDRRAHARIDIERPGTIE-AGGRTYAVQVRDISEAGARLADAIEALGPDCAVTLGIDGLP 622

Query: 70  GRIEGKVVNFDSNRGYAVRIVTSE 93
           G++ G +V  D +R   V+   SE
Sbjct: 623 GKLHGVIVASDPDRT-LVKFDLSE 645


>gi|158320536|ref|YP_001513043.1| type IV pilus assembly PilZ [Alkaliphilus oremlandii OhILAs]
 gi|158140735|gb|ABW19047.1| type IV pilus assembly PilZ [Alkaliphilus oremlandii OhILAs]
          Length = 218

 Score = 36.4 bits (83), Expect = 2.8,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 46/92 (50%), Gaps = 14/92 (15%)

Query: 4   GIHNLQFIDQRAFQRVKVDLKGRFLLFDGT-----EYNCIVREISPGGLCIVCDVPMFLV 58
              +++ I +R + R+ + L    +L         EY+C+ +++S GG+ ++C   +  +
Sbjct: 94  PTSSIERIQRRNYYRLPIVLP--CVLKKQENDKVVEYSCVSKDLSGGGIKLICKQEI-NL 150

Query: 59  GERSIVFV----EKVGRIEGKVVNFDSNRGYA 86
            E  +V +    E++  I+GKV+     +G+ 
Sbjct: 151 DENIVVTIKIHEEQMIAIKGKVIRVV--KGFE 180


>gi|300937603|ref|ZP_07152412.1| cellulose synthase catalytic subunit [Escherichia coli MS 21-1]
 gi|300457333|gb|EFK20826.1| cellulose synthase catalytic subunit [Escherichia coli MS 21-1]
          Length = 704

 Score = 36.4 bits (83), Expect = 2.8,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 4/59 (6%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCI----VCDVPMFLVGERSIVFVEK 68
           R   R+ V  KG   L DG  Y C V + S GGL +    + DV      +   +++  
Sbjct: 557 RFSPRIDVSFKGVIKLADGRCYPCSVIDFSEGGLGVIVDHISDVKEIEKTQHLSLYLSD 615



 Score = 34.8 bits (79), Expect = 6.7,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 112 LHLQDCRAYGRKITR-DREVDAQLVLNDNTKHSCKVIDISESGVSVSVDL 160
           L +   +   R   R D      + L D   + C VID SE G+ V VD 
Sbjct: 547 LAVSIEQKQVRFSPRIDVSFKGVIKLADGRCYPCSVIDFSEGGLGVIVDH 596


>gi|154249077|ref|YP_001409902.1| type IV pilus assembly PilZ [Fervidobacterium nodosum Rt17-B1]
 gi|154153013|gb|ABS60245.1| type IV pilus assembly PilZ [Fervidobacterium nodosum Rt17-B1]
          Length = 228

 Score = 36.0 bits (82), Expect = 2.9,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 8   LQFIDQRAFQRVKVDLKGRFLL---FDGTEYNCIVREISPGGLCIVC 51
           ++  ++R F R+ + L GRF L    +   +    R +S GGL +V 
Sbjct: 104 VRKTEKRKFVRIPLYLDGRFYLSTEPEAESFVFTTRNVSAGGLLMVT 150


>gi|134299333|ref|YP_001112829.1| type IV pilus assembly PilZ [Desulfotomaculum reducens MI-1]
 gi|134052033|gb|ABO50004.1| type IV pilus assembly PilZ [Desulfotomaculum reducens MI-1]
          Length = 98

 Score = 36.0 bits (82), Expect = 3.0,   Method: Composition-based stats.
 Identities = 15/69 (21%), Positives = 33/69 (47%), Gaps = 3/69 (4%)

Query: 10 FIDQRAFQRVKVDLKGRFLLFDGTE-YNCIVREISPGGLCIVCDVPMFLVGERSIVFVEK 68
            ++R  +R +++L+      D     N  +  IS GG+   CD  +  +GE  +++   
Sbjct: 4  ARERRKHKRYEIELQAIISKNDHRYLQNVKLINISGGGISFTCDNQIA-IGETIMIYFPF 62

Query: 69 VGRIEGKVV 77
          +  ++G V+
Sbjct: 63 I-TVQGYVI 70


>gi|307726110|ref|YP_003909323.1| cellulose synthase catalytic subunit (UDP-forming) [Burkholderia
           sp. CCGE1003]
 gi|307586635|gb|ADN60032.1| cellulose synthase catalytic subunit (UDP-forming) [Burkholderia
           sp. CCGE1003]
          Length = 734

 Score = 36.0 bits (82), Expect = 3.0,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 27/62 (43%), Gaps = 3/62 (4%)

Query: 117 CRAYGRKITRDR-EVDAQLVLNDNTKHSCKVIDISES--GVSVSVDLQIEMFSKVLFNDI 173
            R   R + R   E+   L  +     +C+ ID SE   GV++   +Q+ M  +V  +  
Sbjct: 573 ERRQIRAVHRVAMEMPVMLKFSTGRTLACRTIDYSEGGVGVALPAAIQVPMHERVTVSLF 632

Query: 174 LG 175
            G
Sbjct: 633 RG 634


>gi|126729578|ref|ZP_01745391.1| hypothetical protein SSE37_03870 [Sagittula stellata E-37]
 gi|126709697|gb|EBA08750.1| hypothetical protein SSE37_03870 [Sagittula stellata E-37]
          Length = 242

 Score = 36.0 bits (82), Expect = 3.1,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 37/94 (39%), Gaps = 8/94 (8%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCD--VPMFLVGERSIVFVEKVGR 71
           R  QRV V +  R  L DG    C + +IS GG  +  D      +      + +   G+
Sbjct: 142 RRSQRVSVKVAARC-LQDGYVIPCEILDISEGGARLRFDSLGIAGIRDAPLNLQIPGYGQ 200

Query: 72  IEGKVVNFDSNRGYA--VRIVTSENERRKLADKL 103
               +  F    G+A       ++ ++  L+ ++
Sbjct: 201 F---LAEFRWRHGFAAGAEFQLTDRQKELLSRRI 231


>gi|94265934|ref|ZP_01289660.1| hypothetical protein MldDRAFT_3859 [delta proteobacterium MLMS-1]
 gi|93453520|gb|EAT03928.1| hypothetical protein MldDRAFT_3859 [delta proteobacterium MLMS-1]
          Length = 366

 Score = 36.0 bits (82), Expect = 3.1,   Method: Composition-based stats.
 Identities = 36/207 (17%), Positives = 66/207 (31%), Gaps = 31/207 (14%)

Query: 6   HNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVR--EISPGGLCIVC-DVPMFLVGERS 62
             L  I +R  +R++V       L   T  +C     ++S  G  ++  D+ +   G+R 
Sbjct: 102 EELYKIQRRREERLEVPEGSSVSLRRTTGNSCHGVPLDLSRCGARMLLRDIAIHRSGDRI 161

Query: 63  --IVF--VEKVGRIE--------GKV--VNFDSNRGYAVRIVTSEN--ERRKLADKLIWL 106
             + F  + K+ R E          V  V     RG  + +        R  LA  L   
Sbjct: 162 GPVSFNLLRKLSRSESISITVPEATVAWVREADGRGTMIGVQFPHEIEGRESLAAWLRMR 221

Query: 107 ANKDDLHLQ------------DCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGV 154
             ++ L  +            D R   R    D  V                +DIS +G 
Sbjct: 222 EEEEKLLTEQSEKSDVGEITDDRRRQERVTPADHSVLTMAAPGGGRLLRAVAVDISRTGA 281

Query: 155 SVSVDLQIEMFSKVLFNDILGRVVRIF 181
            ++ +    +   ++   +   + R  
Sbjct: 282 RITGNFPAGLQRGMVVGPLTFTLNRQL 308


>gi|323934087|gb|EGB30530.1| cellulose synthase catalytic [Escherichia coli E1520]
          Length = 701

 Score = 36.0 bits (82), Expect = 3.4,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 27/67 (40%), Gaps = 5/67 (7%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIV----CDVPMFLVGERSIVFVEKV 69
           R   R++V   G  LL +GT   C V + S GGL I      D       +   +++   
Sbjct: 557 RVSPRIEVVFSGHLLLTNGTRNPCSVIDFSEGGLGITLHGGVDNRNIEKNKPMTLYL-HT 615

Query: 70  GRIEGKV 76
           G  E  +
Sbjct: 616 GDEECAI 622



 Score = 35.2 bits (80), Expect = 5.5,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 6/61 (9%)

Query: 103 LIWLANKDD-----LHLQDCRAYGRKITRDREVDA-QLVLNDNTKHSCKVIDISESGVSV 156
           L+WLA         L +   +   R   R   V +  L+L + T++ C VID SE G+ +
Sbjct: 533 LMWLAYNTIIIGATLAVSIEQKQVRVSPRIEVVFSGHLLLTNGTRNPCSVIDFSEGGLGI 592

Query: 157 S 157
           +
Sbjct: 593 T 593


>gi|114328370|ref|YP_745527.1| gamma-glutamyl kinase [Granulibacter bethesdensis CGDNIH1]
 gi|114316544|gb|ABI62604.1| glutamate 5-kinase [Granulibacter bethesdensis CGDNIH1]
          Length = 381

 Score = 36.0 bits (82), Expect = 3.4,   Method: Composition-based stats.
 Identities = 27/137 (19%), Positives = 46/137 (33%), Gaps = 12/137 (8%)

Query: 47  LCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVT--SENERRKLA--DK 102
           +  +      + GE    +     R +       +  G A+ I    +++  R LA   +
Sbjct: 206 VRAITPEIEAMGGEPPPGYSSGGMRTKLTAARIATGAGCAMAIALGHTDHPLRALAEGAR 265

Query: 103 LIWLANKDDLHLQDCRAY-GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSV-SVDL 160
             W      L L + R    R I    +    L ++D  +    +   S     V SVD 
Sbjct: 266 CTWF-----LPLPEGRTARKRWIAGSLQPMGTLTVDDGARR-ALLRGGSLLPAGVVSVDG 319

Query: 161 QIEMFSKVLFNDILGRV 177
           + E    VL   + G V
Sbjct: 320 RFERGDPVLVQGLDGTV 336


>gi|324113959|gb|EGC07933.1| YcgR protein [Escherichia fergusonii B253]
          Length = 244

 Score = 36.0 bits (82), Expect = 3.4,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 20/55 (36%), Gaps = 1/55 (1%)

Query: 110 DDLHLQDCRAYGRK-ITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIE 163
             L     R Y R              L DN+K  C++ D+S  G+ V ++    
Sbjct: 106 QSLWFVQRRKYFRISAPLHPPYYCTAQLPDNSKLRCRLYDLSLGGMGVLLETAPP 160


>gi|325497530|gb|EGC95389.1| regulator [Escherichia fergusonii ECD227]
          Length = 244

 Score = 36.0 bits (82), Expect = 3.5,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 20/55 (36%), Gaps = 1/55 (1%)

Query: 110 DDLHLQDCRAYGRK-ITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIE 163
             L     R Y R              L DN+K  C++ D+S  G+ V ++    
Sbjct: 106 QSLWFVQRRKYFRISAPLHPPYYCTAQLPDNSKLRCRLYDLSLGGMGVLLETAPP 160


>gi|218549109|ref|YP_002382900.1| regulator [Escherichia fergusonii ATCC 35469]
 gi|218356650|emb|CAQ89276.1| putative regulator [Escherichia fergusonii ATCC 35469]
          Length = 244

 Score = 36.0 bits (82), Expect = 3.5,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 20/55 (36%), Gaps = 1/55 (1%)

Query: 110 DDLHLQDCRAYGRK-ITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIE 163
             L     R Y R              L DN+K  C++ D+S  G+ V ++    
Sbjct: 106 QSLWFVQRRKYFRISAPLHPPYYCTAQLPDNSKLRCRLYDLSLGGMGVLLETAPP 160


>gi|34498133|ref|NP_902348.1| cellulose synthase subunit A [Chromobacterium violaceum ATCC 12472]
 gi|34103988|gb|AAQ60348.1| cellulose synthase, subunit A [Chromobacterium violaceum ATCC
           12472]
          Length = 852

 Score = 36.0 bits (82), Expect = 3.5,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 23/52 (44%), Gaps = 3/52 (5%)

Query: 114 LQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMF 165
           L+  RA  R         A L L D   H C+++D SE G+++ +  +    
Sbjct: 683 LRQVRAAHRV---RASRQAALHLPDGRVHRCRMLDYSEGGMALQLAREPRSG 731


>gi|295699210|ref|YP_003607103.1| cellulose synthase catalytic subunit (UDP-forming) [Burkholderia
           sp. CCGE1002]
 gi|295438423|gb|ADG17592.1| cellulose synthase catalytic subunit (UDP-forming) [Burkholderia
           sp. CCGE1002]
          Length = 735

 Score = 36.0 bits (82), Expect = 3.5,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 25/62 (40%), Gaps = 3/62 (4%)

Query: 117 CRAYGRKITRDR-EVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQI--EMFSKVLFNDI 173
            R   R + R   ++   L  +     +C+ ID SE GV V +   I   M  +V  +  
Sbjct: 574 ERRQIRAVPRVAMKMPVMLKFSTGRTLACETIDYSEGGVGVKLPSTIEVPMQERVTVSLF 633

Query: 174 LG 175
            G
Sbjct: 634 RG 635


>gi|227113869|ref|ZP_03827525.1| cellulose synthase catalytic subunit [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 899

 Score = 36.0 bits (82), Expect = 3.6,   Method: Composition-based stats.
 Identities = 13/61 (21%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 7   NLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVC-DVPMFLVGERSIVF 65
            ++    R   RV++ +    L  DG  + C++R+ S GG+ +   +  +  VG+   + 
Sbjct: 689 AVEAKQVRQAHRVEMSMSAAILRADGHLFPCVLRDYSDGGVGVEARESGILQVGDSVSLL 748

Query: 66  V 66
           +
Sbjct: 749 L 749


>gi|114319323|ref|YP_741006.1| type IV pilus assembly PilZ [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225717|gb|ABI55516.1| type IV pilus assembly PilZ [Alkalilimnicola ehrlichii MLHE-1]
          Length = 212

 Score = 36.0 bits (82), Expect = 3.6,   Method: Composition-based stats.
 Identities = 18/89 (20%), Positives = 28/89 (31%), Gaps = 10/89 (11%)

Query: 117 CRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLF-----N 171
            R   R++ +   V          +  C + D+S  G +V     +    +V        
Sbjct: 117 DRRRHRRVPQGCPVSLW---AHGRRTECAMRDLSRGGAAVEDCDGLNPGDRVSVRIPGFG 173

Query: 172 DILGRVVRIFPGGIAIEFSS--VQESNIA 198
             L  VVR     I + F S    E   A
Sbjct: 174 MKLAAVVRTRVNRIGLAFESQLPWEPRPA 202



 Score = 35.6 bits (81), Expect = 4.1,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 32/87 (36%), Gaps = 3/87 (3%)

Query: 11  IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
           +D+R  +RV        L   G    C +R++S GG  +  D      G+R  V +   G
Sbjct: 116 VDRRRHRRVPQGCPVS-LWAHGRRTECAMRDLSRGGAAVE-DCDGLNPGDRVSVRIPGFG 173

Query: 71  -RIEGKVVNFDSNRGYAVRIVTSENER 96
            ++   V    +  G A         R
Sbjct: 174 MKLAAVVRTRVNRIGLAFESQLPWEPR 200


>gi|209522500|ref|ZP_03271092.1| cellulose synthase catalytic subunit (UDP-forming) [Burkholderia
           sp. H160]
 gi|209497066|gb|EDZ97329.1| cellulose synthase catalytic subunit (UDP-forming) [Burkholderia
           sp. H160]
          Length = 735

 Score = 35.6 bits (81), Expect = 3.7,   Method: Composition-based stats.
 Identities = 15/62 (24%), Positives = 28/62 (45%), Gaps = 3/62 (4%)

Query: 117 CRAYGRKITRDR-EVDAQLVLNDNTKHSCKVIDISESGVSVSVD--LQIEMFSKVLFNDI 173
            R   R + R   ++   L  +     +C+ ID SE GV V++   +++ M  +V  +  
Sbjct: 574 ERRQIRAVPRVAMKMPVMLKFSTGRTLACETIDYSEGGVGVALPGNIEVPMQERVSVSLF 633

Query: 174 LG 175
            G
Sbjct: 634 RG 635


>gi|167615538|ref|ZP_02384173.1| glycosyl transferase, group 2 family protein [Burkholderia
           thailandensis Bt4]
          Length = 679

 Score = 35.6 bits (81), Expect = 3.7,   Method: Composition-based stats.
 Identities = 27/113 (23%), Positives = 44/113 (38%), Gaps = 9/113 (7%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCI-VCDVPMFLVGERSIVFVEKVGR- 71
           R   R+ + +    LL DGT   C  ++ S GGL +    +    +G+   V V +  R 
Sbjct: 528 RVTHRIAMRVPATLLLPDGTTLACRTKDYSAGGLGLDAVPLARIALGDTLDVCVSRGDRP 587

Query: 72  --IEGKVVNFD-SNRGYAVRIVTSENERRKLADKL----IWLANKDDLHLQDC 117
                +V   D ++ G     +T E ER+ +         WL  +D     D 
Sbjct: 588 FHFPVRVTRVDATHLGVQFERLTLEQERQLVQCTFGRADAWLGWRDASAEPDD 640


>gi|320547940|ref|ZP_08042223.1| glycosyltransferase [Streptococcus equinus ATCC 9812]
 gi|320447480|gb|EFW88240.1| glycosyltransferase [Streptococcus equinus ATCC 9812]
          Length = 747

 Score = 35.6 bits (81), Expect = 3.8,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 38/99 (38%), Gaps = 20/99 (20%)

Query: 115 QDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQ---IE-------M 164
              R   R I  +  V       D   +  +V DISE+G+S S  L             +
Sbjct: 510 PTYRNSERFIVDEPMVID----ADGESYDVRVCDISETGISFSSPLPLYLPPKKELTLHL 565

Query: 165 FSKVLFNDILGRVVRIFPGG------IAIEFSSVQESNI 197
            S+       G VVR+            ++F+SV++++I
Sbjct: 566 QSRNYRALTKGHVVRVVVNDEAKGWRYGVQFTSVEKADI 604


>gi|127513736|ref|YP_001094933.1| type IV pilus assembly PilZ [Shewanella loihica PV-4]
 gi|126639031|gb|ABO24674.1| type IV pilus assembly PilZ [Shewanella loihica PV-4]
          Length = 796

 Score = 35.6 bits (81), Expect = 3.9,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 58/150 (38%), Gaps = 22/150 (14%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIV--------- 64
           RA +R+   ++   L    +E   I  ++S GG  I   V   L  E+ ++         
Sbjct: 143 RAEERMNYAIRIGVLQPGRSEVKGITVDLSVGGARIRLPVDHGLNPEQPLIVKLLELSAE 202

Query: 65  -FVEKVGR-IEGKVVNFDSNRGYA-VRIV---TSENERRKLADKLIWLANKDDLHLQD-- 116
            + + + + +E +VV+ +SN  ++ +R+     S+     LA+ +     +  + + D  
Sbjct: 203 YYFDDLQKGVEYQVVDVESNHEFSWMRLKRVGGSDALSDMLANLIQGYKFRYKVDINDIL 262

Query: 117 ----CRAYGR-KITRDREVDAQLVLNDNTK 141
                  + R  +     +   + L D   
Sbjct: 263 VAATGLGFERHYLPHLPHLPLYVELKDGQH 292


>gi|254561578|ref|YP_003068673.1| methyl-accepting chemotaxis receptor/sensory transducer with PAS
           domain [Methylobacterium extorquens DM4]
 gi|254268856|emb|CAX24817.1| methyl-accepting chemotaxis receptor/sensory transducer with PAS
           domain [Methylobacterium extorquens DM4]
          Length = 654

 Score = 35.6 bits (81), Expect = 4.0,   Method: Composition-based stats.
 Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 4/54 (7%)

Query: 141 KHSCKVIDISESGV--SVSVDLQIEMFSKVLFN--DILGRVVRIFPGGIAIEFS 190
              C V+++SE G   ++       + +  +        RV+R    GI ++F 
Sbjct: 601 SRPCTVLNLSEGGAKLALEAADLPNLVTLHIDGEPSRRCRVIRRADDGIGVQFV 654


>gi|327478942|gb|AEA82252.1| cellulose synthase catalytic subunit [Pseudomonas stutzeri DSM
           4166]
          Length = 865

 Score = 35.6 bits (81), Expect = 4.0,   Method: Composition-based stats.
 Identities = 16/90 (17%), Positives = 31/90 (34%), Gaps = 11/90 (12%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIE 73
           R   RV   L     L DG  Y C + + + GG  +     + +  ++ +  + + G   
Sbjct: 696 RRAHRVMAQLPASLKLADGHAYPCTLLDFAEGGAGLQIPPGLKVDMDQPVSLILQRG--- 752

Query: 74  GKVVNFDSNRGYAVRIVTSENERRKLADKL 103
                   +R +      S     +L  +L
Sbjct: 753 --------DRSFMFSGQASRQIGERLGIRL 774


>gi|258653229|ref|YP_003202385.1| extracellular ligand-binding receptor [Nakamurella multipartita DSM
           44233]
 gi|258556454|gb|ACV79396.1| Extracellular ligand-binding receptor [Nakamurella multipartita DSM
           44233]
          Length = 425

 Score = 35.6 bits (81), Expect = 4.1,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 20/52 (38%), Gaps = 1/52 (1%)

Query: 126 RDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRV 177
           +   V   LV     K  C + D S  G  ++ ++   + S V      G+V
Sbjct: 217 QGPSVGKYLVNTLGYKKVCVIDDSSSYGAGLAAEVTPALGSAVD-GGCTGQV 267


>gi|162454134|ref|YP_001616501.1| hypothetical protein sce5858 [Sorangium cellulosum 'So ce 56']
 gi|161164716|emb|CAN96021.1| hypothetical protein predicted by Glimmer/Critica [Sorangium
           cellulosum 'So ce 56']
          Length = 101

 Score = 35.6 bits (81), Expect = 4.2,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 31/86 (36%), Gaps = 13/86 (15%)

Query: 114 LQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLF--- 170
           ++D R + R   +  E+     + D  +      D+S  G+ +         + V     
Sbjct: 1   MRDHRKHPR---KQIELSIAFRIGDGPRVDAICRDLSLGGMFIETSSPAPFGATVEVLLS 57

Query: 171 ------NDILGRVVRI-FPGGIAIEF 189
                   ++  VVR   P G+ ++F
Sbjct: 58  LQGLKQVAVIPSVVRWTTPEGMGVQF 83


>gi|148269167|ref|YP_001243627.1| type IV pilus assembly PilZ [Thermotoga petrophila RKU-1]
 gi|170287829|ref|YP_001738067.1| type IV pilus assembly PilZ [Thermotoga sp. RQ2]
 gi|281411465|ref|YP_003345544.1| type IV pilus assembly PilZ [Thermotoga naphthophila RKU-10]
 gi|147734711|gb|ABQ46051.1| type IV pilus assembly PilZ [Thermotoga petrophila RKU-1]
 gi|170175332|gb|ACB08384.1| type IV pilus assembly PilZ [Thermotoga sp. RQ2]
 gi|281372568|gb|ADA66130.1| type IV pilus assembly PilZ [Thermotoga naphthophila RKU-10]
          Length = 229

 Score = 35.6 bits (81), Expect = 4.4,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 6   HNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCI--VREISPGGLCIVC 51
             L+ I +R F+R+K+ L+G + +    E       ++ S GG+ +V 
Sbjct: 104 ERLRKIQRRRFKRIKIFLEGTYRVASRDEPPKRFVTKDFSAGGMLMVA 151


>gi|86138460|ref|ZP_01057034.1| hypothetical protein MED193_05131 [Roseobacter sp. MED193]
 gi|85824985|gb|EAQ45186.1| hypothetical protein MED193_05131 [Roseobacter sp. MED193]
          Length = 279

 Score = 35.6 bits (81), Expect = 4.5,   Method: Composition-based stats.
 Identities = 16/63 (25%), Positives = 30/63 (47%), Gaps = 4/63 (6%)

Query: 146 VIDISESGVSVSVDLQIEMFSKV---LFNDIL-GRVVRIFPGGIAIEFSSVQESNIAFKS 201
           ++D+S +G  V +   I    +V      +   GRVVR   G I + F ++  + +  K+
Sbjct: 206 IVDLSRAGAIVDLKKSIAQGEEVELNFLGETATGRVVRNKNGSITLNFLTMLNTAVIDKA 265

Query: 202 LIN 204
           L +
Sbjct: 266 LFD 268


>gi|29833605|ref|NP_828239.1| hypothetical protein SAV_7063 [Streptomyces avermitilis MA-4680]
 gi|29610729|dbj|BAC74774.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 477

 Score = 35.6 bits (81), Expect = 4.7,   Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 31/92 (33%), Gaps = 9/92 (9%)

Query: 70  GRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDRE 129
           G +EG V+   +  G  + +      R  L       A    L   D     R   R   
Sbjct: 243 GALEGTVLRLRAPEGGVITVE-----RPYLPFTPTEFARARALVELD----ARLGPRIPR 293

Query: 130 VDAQLVLNDNTKHSCKVIDISESGVSVSVDLQ 161
               L L + +  + +  D+S+   + ++  +
Sbjct: 294 SHDVLQLPEGSAITVRRADVSDLAAAKAMHER 325


>gi|297570267|ref|YP_003691611.1| type IV pilus assembly PilZ [Desulfurivibrio alkaliphilus AHT2]
 gi|296926182|gb|ADH86992.1| type IV pilus assembly PilZ [Desulfurivibrio alkaliphilus AHT2]
          Length = 127

 Score = 35.6 bits (81), Expect = 4.8,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 32/84 (38%), Gaps = 14/84 (16%)

Query: 117 CRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLF-----N 171
            R +  ++    +  A L  + +T   C+  D+S  GVSV      ++  +         
Sbjct: 5   NRRHNSRVP--FQATATLRFDHHTYEHCQTSDLSLKGVSVEGINGHQVGEQCRVELYLTG 62

Query: 172 D-------ILGRVVRIFPGGIAIE 188
                   + G VVR+   G+A+ 
Sbjct: 63  STSNLRLQMKGEVVRVEQNGLALR 86


>gi|222054947|ref|YP_002537309.1| type IV pilus assembly PilZ [Geobacter sp. FRC-32]
 gi|221564236|gb|ACM20208.1| type IV pilus assembly PilZ [Geobacter sp. FRC-32]
          Length = 122

 Score = 35.6 bits (81), Expect = 4.8,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 30/83 (36%), Gaps = 12/83 (14%)

Query: 122 RKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLF-----NDIL-- 174
           R  +R       LV         +V +IS  G+ +  D +++    V             
Sbjct: 5   RNFSRVSFAIDALVTQAEITIKGEVRNISLQGLYIETDGKLDAGLPVDVSIQLSGTTPEV 64

Query: 175 -----GRVVRIFPGGIAIEFSSV 192
                G VVRI   G+ I+FS +
Sbjct: 65  AIKATGSVVRIDENGVGIKFSKI 87


>gi|254504114|ref|ZP_05116265.1| Type IV pilus assembly protein PilZ [Labrenzia alexandrii DFL-11]
 gi|222440185|gb|EEE46864.1| Type IV pilus assembly protein PilZ [Labrenzia alexandrii DFL-11]
          Length = 537

 Score = 35.2 bits (80), Expect = 5.0,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 38/94 (40%), Gaps = 8/94 (8%)

Query: 101 DKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDL 160
           DKL+ LA   +  LQD     R+  R           D    + ++ ++S +G ++   +
Sbjct: 442 DKLVLLAKAMENELQDA--EARRSPRKDTTAVTQAQVDGRTQTVEIENVSRTGAALKGLI 499

Query: 161 QIEMFSKVLF----NDILGRVVRIFPGGI-AIEF 189
            +E    V       + LG VV     G+  I+F
Sbjct: 500 GVEKGMTVSVMIDDQERLGHVV-WTDAGMTGIQF 532


>gi|254443868|ref|ZP_05057344.1| GAF domain protein [Verrucomicrobiae bacterium DG1235]
 gi|198258176|gb|EDY82484.1| GAF domain protein [Verrucomicrobiae bacterium DG1235]
          Length = 598

 Score = 35.2 bits (80), Expect = 5.0,   Method: Composition-based stats.
 Identities = 32/161 (19%), Positives = 55/161 (34%), Gaps = 33/161 (20%)

Query: 32  GTEYNCIVREI--SPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRI 89
             E+      I  S     +    P          ++++V R  G +V  D      + +
Sbjct: 353 RIEHKVKTTFILKSEASAYLTAPFPG---------YIDQVHRDVGDIVEADD---LLMEL 400

Query: 90  VTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKV--I 147
                 RR+L  +L  L    D +L D R   R        + +L      +   K+  +
Sbjct: 401 D-----RRELVVQLAELNANRDRNLTDAR---RLEGEGELTEMRLAQLAAQQVEAKIAVL 452

Query: 148 DISES---------GVSVSVDLQIEMFSKVLFNDILGRVVR 179
           D   S         G+ V  DL+  + S V   + L R+V+
Sbjct: 453 DYRLSKTELRAPFDGIIVEGDLRERLSSPVQAGETLYRLVK 493


>gi|158520900|ref|YP_001528770.1| type IV pilus assembly PilZ [Desulfococcus oleovorans Hxd3]
 gi|158509726|gb|ABW66693.1| type IV pilus assembly PilZ [Desulfococcus oleovorans Hxd3]
          Length = 167

 Score = 35.2 bits (80), Expect = 5.1,   Method: Composition-based stats.
 Identities = 17/85 (20%), Positives = 33/85 (38%), Gaps = 14/85 (16%)

Query: 116 DCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFN---- 171
           D R + RK  R      +  ++  T  +    DIS  G+ +    ++     +  +    
Sbjct: 80  DKRQHPRKPLRLNVSVTRGEVS-GTSMA---RDISLGGLFLETIEEMAPGQVLQLSIPFT 135

Query: 172 ------DILGRVVRIFPGGIAIEFS 190
                  + G+VVR+   G+ +EF 
Sbjct: 136 NQDRQIKVKGKVVRMTEDGVGVEFD 160


>gi|148258158|ref|YP_001242743.1| putative methyl-accepting chemotaxis receptor/sensory transducer
           [Bradyrhizobium sp. BTAi1]
 gi|146410331|gb|ABQ38837.1| Putative methyl-accepting chemotaxis receptor/sensory transducer
           [Bradyrhizobium sp. BTAi1]
          Length = 661

 Score = 35.2 bits (80), Expect = 5.1,   Method: Composition-based stats.
 Identities = 16/95 (16%), Positives = 37/95 (38%), Gaps = 10/95 (10%)

Query: 117 CRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVS-VDLQIEMFSKVLFN---- 171
            R    ++  +R    Q+   +    +  V ++S  G  +  + +Q+ + + V       
Sbjct: 565 DRRLSTRLNINRPGTLQV---NGAPIAVTVRNLSLGGALLEQIPVQLSINTPVALGITGM 621

Query: 172 --DILGRVVRIFPGGIAIEFSSVQESNIAFKSLIN 204
             D+ G V R+      ++F+   E      +LI+
Sbjct: 622 VSDLPGTVTRVSDRTALVQFTLNTEQAARLTALIS 656


>gi|332297932|ref|YP_004439854.1| type IV pilus assembly PilZ [Treponema brennaborense DSM 12168]
 gi|332181035|gb|AEE16723.1| type IV pilus assembly PilZ [Treponema brennaborense DSM 12168]
          Length = 369

 Score = 35.2 bits (80), Expect = 5.4,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 72/182 (39%), Gaps = 31/182 (17%)

Query: 2   YRGIHNLQFIDQRAFQRVKVDLKG---RFLLFDGTEYNCIVREISPGGLCIVCDVPMFLV 58
            +G+ + +++D+    RV +   G    +++ +  E   ++ ++ P    I+       V
Sbjct: 110 KKGLQSTKYLDENQKIRVVLKNSGVFASYIIRNARE---LIVKM-PSKKGIITMFGSEWV 165

Query: 59  GERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADK-LIWLANKDDLHLQDC 117
           G++  V++ +           D++  +   ++ +       A + +++LA+ D L     
Sbjct: 166 GKQISVYLWR---------RNDAHYVFDTTVLNAGQ----FASQPVLYLAHSDSLTRAQK 212

Query: 118 RAYGRKITRDREVDAQL---------VLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKV 168
           R   R +      D  L         VL +   + C + DIS  G  + +  +  + +++
Sbjct: 213 RREVR-VPSRVYADMYLAAKNFKDDTVLEEKEGYRCLLEDISVGGALIRIGGKCPVQTRM 271

Query: 169 LF 170
             
Sbjct: 272 KI 273


>gi|240138970|ref|YP_002963445.1| methyl-accepting chemotaxis receptor/sensory transducer with PAS
           domain [Methylobacterium extorquens AM1]
 gi|240008942|gb|ACS40168.1| methyl-accepting chemotaxis receptor/sensory transducer with PAS
           domain [Methylobacterium extorquens AM1]
          Length = 654

 Score = 35.2 bits (80), Expect = 5.4,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 23/54 (42%), Gaps = 4/54 (7%)

Query: 141 KHSCKVIDISESGV--SVSVDLQIEMFSKVLFN--DILGRVVRIFPGGIAIEFS 190
              C V+++SE G   ++      E+ +  +        RV+R    GI ++F 
Sbjct: 601 SRPCTVLNLSEGGAKLALEAADLPEVVTLHIDGEPSRRCRVIRRAADGIGVQFV 654


>gi|297568833|ref|YP_003690177.1| response regulator receiver modulated PilZ sensor protein
           [Desulfurivibrio alkaliphilus AHT2]
 gi|296924748|gb|ADH85558.1| response regulator receiver modulated PilZ sensor protein
           [Desulfurivibrio alkaliphilus AHT2]
          Length = 258

 Score = 35.2 bits (80), Expect = 5.5,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 25/58 (43%), Gaps = 4/58 (6%)

Query: 109 KDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSV-SVDLQIEMF 165
           +  L++ + R   R      E  A L + D    S +++DIS +G ++  +     + 
Sbjct: 120 RSSLNVMNRRREQRYA--LPEHVATLRV-DKKIFSGRLLDISRTGAALGGMKFDPALG 174


>gi|330821981|ref|YP_004350843.1| hypothetical protein bgla_2g29160 [Burkholderia gladioli BSR3]
 gi|327373976|gb|AEA65331.1| hypothetical protein bgla_2g29160 [Burkholderia gladioli BSR3]
          Length = 292

 Score = 35.2 bits (80), Expect = 5.6,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%)

Query: 8   LQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERS 62
           L+ + +R   RV V L  R++L        +V ++SP GL I  D  +   GE  
Sbjct: 176 LKRVRERRDTRVAVRLAARYVLSSARG-TGLVLDVSPSGLSIAVDRELGKAGESL 229


>gi|294625745|ref|ZP_06704365.1| celullose synthase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|292599981|gb|EFF44098.1| celullose synthase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
          Length = 731

 Score = 35.2 bits (80), Expect = 5.7,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 41/117 (35%), Gaps = 15/117 (12%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVP-MFLVGERSIVFVEKVGRI 72
           R+  RV +D+     L DG          S GG+ I+   P     G    + +   G +
Sbjct: 579 RSAHRVPLDVPVTLYLPDGGALPSRSVNFSTGGMAIMLAQPQPIEPGLPVQIGLSHRG-V 637

Query: 73  EGK---VVNFDSNRGYAVRIVTSENERRKLADKLIWL----ANKDDLHLQDCRAYGR 122
           E     VV  D +   +++      E+ +      WL      + D+ L     + R
Sbjct: 638 EQTLPAVVRQDRDGQVSIQFTQMSMEQER------WLVASTFARADIWLSQWGQHDR 688


>gi|172060351|ref|YP_001808003.1| cellulose synthase catalytic subunit (UDP-forming) [Burkholderia
           ambifaria MC40-6]
 gi|171992868|gb|ACB63787.1| cellulose synthase catalytic subunit (UDP-forming) [Burkholderia
           ambifaria MC40-6]
          Length = 845

 Score = 35.2 bits (80), Expect = 5.7,   Method: Composition-based stats.
 Identities = 18/85 (21%), Positives = 31/85 (36%), Gaps = 11/85 (12%)

Query: 119 AYGRKITRDR-EVDAQLVLNDNTKHSCKVIDISESGVSVSV--DLQIEMFSKVLFNDILG 175
              R   R    V A L+L D +  +C   D S  G+ +     L + +   +      G
Sbjct: 691 RQVRVTHRIAMRVPATLLLADGSTAACFTSDYSTGGLGLEAVPGLPLAIGDTLTVCVTRG 750

Query: 176 --------RVVRIFPGGIAIEFSSV 192
                   RV R+ P  + + F ++
Sbjct: 751 DRPFPFPVRVSRVTPTHVGVSFEAL 775


>gi|170746678|ref|YP_001752938.1| hypothetical protein Mrad2831_0229 [Methylobacterium
          radiotolerans JCM 2831]
 gi|170653200|gb|ACB22255.1| conserved hypothetical protein [Methylobacterium radiotolerans
          JCM 2831]
          Length = 83

 Score = 35.2 bits (80), Expect = 5.8,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 20/38 (52%)

Query: 13 QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIV 50
          QR  +RV V+L GR  +       C+V ++S  G+ + 
Sbjct: 4  QRNARRVSVNLNGRISVAGHPAIPCVVHDMSRWGVRLR 41


>gi|170742647|ref|YP_001771302.1| type IV pilus assembly PilZ [Methylobacterium sp. 4-46]
 gi|168196921|gb|ACA18868.1| type IV pilus assembly PilZ [Methylobacterium sp. 4-46]
          Length = 118

 Score = 35.2 bits (80), Expect = 5.8,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 13 QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
          +RA  R+   + GR  L  GT   C+VR IS GG  +       L  E+  ++VE++G
Sbjct: 9  RRANPRIPTFMGGRIRLPGGTGVTCVVRNISAGGALLDVSNAAVLP-EQVDLWVEQIG 65


>gi|149185877|ref|ZP_01864192.1| hypothetical protein ED21_24126 [Erythrobacter sp. SD-21]
 gi|148830438|gb|EDL48874.1| hypothetical protein ED21_24126 [Erythrobacter sp. SD-21]
          Length = 101

 Score = 35.2 bits (80), Expect = 5.9,   Method: Composition-based stats.
 Identities = 16/66 (24%), Positives = 32/66 (48%)

Query: 11 IDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG 70
          ++ R  QR  + ++GR+    G  ++  ++++S  G      V     G++  V V +VG
Sbjct: 1  MELRREQRYSISVRGRYRKGTGVRFDIAIKDLSEYGCQFADLVGRVSQGDQITVRVGEVG 60

Query: 71 RIEGKV 76
           I  +V
Sbjct: 61 PIAAQV 66


>gi|297569587|ref|YP_003690931.1| response regulator receiver modulated PilZ sensor protein
           [Desulfurivibrio alkaliphilus AHT2]
 gi|296925502|gb|ADH86312.1| response regulator receiver modulated PilZ sensor protein
           [Desulfurivibrio alkaliphilus AHT2]
          Length = 257

 Score = 35.2 bits (80), Expect = 6.0,   Method: Composition-based stats.
 Identities = 13/91 (14%), Positives = 30/91 (32%), Gaps = 23/91 (25%)

Query: 109 KDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVD-LQIEMF-- 165
           +  L++   R   R        +  L      +   +++D+S +G + + +     +   
Sbjct: 120 RSSLNVLCQRQAKRYALPAHVAEIHLK---GKRIPGRLLDLSRTGAAFAGEKFDPNLGLF 176

Query: 166 -----------------SKVLFNDILGRVVR 179
                              VL + + GR+VR
Sbjct: 177 KPCELDLRLRDPDGLERDTVLISGLTGRIVR 207


>gi|294011410|ref|YP_003544870.1| hypothetical protein SJA_C1-14240 [Sphingobium japonicum UT26S]
 gi|292674740|dbj|BAI96258.1| hypothetical protein SJA_C1-14240 [Sphingobium japonicum UT26S]
          Length = 117

 Score = 35.2 bits (80), Expect = 6.3,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 32/100 (32%), Gaps = 10/100 (10%)

Query: 101 DKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDL 160
             L  L    D  +   RA    +     + AQ        H  ++I+IS  G+    + 
Sbjct: 6   ASLSHLNQSRDSAVNQRRAQRDLVDMVSHITAQ-----GRTHGTRIINISALGLMCRTEA 60

Query: 161 QIEMFSKVL----FNDILGRVVRIFPGG-IAIEFSSVQES 195
            + M  +V             VR    G I +EF    E 
Sbjct: 61  PLGMGERVTIWLPVVKDHAAEVRWSEDGRIGVEFLKPIEP 100


>gi|78066001|ref|YP_368770.1| cellulose synthase (UDP-forming) [Burkholderia sp. 383]
 gi|77966746|gb|ABB08126.1| Cellulose synthase (UDP-forming) [Burkholderia sp. 383]
          Length = 845

 Score = 35.2 bits (80), Expect = 6.3,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 10/74 (13%)

Query: 129 EVDAQLVLNDNTKHSCKVIDISESGVSVSV--DLQIEMFSKVLFNDILG--------RVV 178
            V A L+L D +  +C   D S  G+ +     L + +   +      G        RV 
Sbjct: 702 RVPAMLLLADGSTAACFTSDYSTGGLGLEAVPGLPLAVGDTLTVCVTRGDRSFPFPVRVT 761

Query: 179 RIFPGGIAIEFSSV 192
           R+ P  + + F  +
Sbjct: 762 RVTPTHVGVSFDEL 775


>gi|325284321|ref|YP_004256861.1| hypothetical protein Deipr_2374 [Deinococcus proteolyticus MRP]
 gi|324316385|gb|ADY27498.1| hypothetical protein Deipr_2374 [Deinococcus proteolyticus MRP]
          Length = 252

 Score = 34.8 bits (79), Expect = 6.6,   Method: Composition-based stats.
 Identities = 11/47 (23%), Positives = 20/47 (42%), Gaps = 1/47 (2%)

Query: 106 LANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISES 152
           LA +   HL++ R+Y      +     QL L      +  +I+ S +
Sbjct: 95  LAKRHQGHLREGRSYSLYHPGNTTTPGQLRLPKGRWITA-IIEQSST 140


>gi|330994518|ref|ZP_08318442.1| Putative cellulose synthase 3 [Gluconacetobacter sp. SXCC-1]
 gi|329758372|gb|EGG74892.1| Putative cellulose synthase 3 [Gluconacetobacter sp. SXCC-1]
          Length = 1422

 Score = 34.8 bits (79), Expect = 6.7,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 20/60 (33%), Gaps = 1/60 (1%)

Query: 4   GIHNLQFIDQRAF-QRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERS 62
           G+   +   QR    RV   L    +   G  + C   ++S GG  +         G R 
Sbjct: 485 GVAAARETRQRRHSHRVAASLPFELVDAQGQVHACRSVDVSMGGCQLDAATVPGAAGGRV 544


>gi|323529614|ref|YP_004231766.1| cellulose synthase catalytic subunit [Burkholderia sp. CCGE1001]
 gi|323386616|gb|ADX58706.1| cellulose synthase catalytic subunit (UDP-forming) [Burkholderia
           sp. CCGE1001]
          Length = 734

 Score = 34.8 bits (79), Expect = 6.7,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 3/62 (4%)

Query: 117 CRAYGRKITRDR-EVDAQLVLNDNTKHSCKVIDISES--GVSVSVDLQIEMFSKVLFNDI 173
            R   R + R   E+   L  +     +CK ID SE   GV++   +Q+ M  +V  +  
Sbjct: 573 ERRQIRAVHRVAMEMPVMLKFSTGRTLACKTIDYSEGGVGVALPAAIQVPMHERVTVSLF 632

Query: 174 LG 175
            G
Sbjct: 633 RG 634


>gi|269217645|ref|ZP_06161499.1| aminopeptidase [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269212580|gb|EEZ78920.1| aminopeptidase [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 440

 Score = 34.8 bits (79), Expect = 7.0,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 25/56 (44%), Gaps = 4/56 (7%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVRE---ISPGGLCIVCDVPMFLVGERSIVFV 66
           R  +   ++   R+ L D  EY C+V +    SP       D    +VG + +V++
Sbjct: 237 REGEMTPLEFAARY-LPDLGEYVCLVNDPRPTSPYNALFTVDRLGNVVGAKPVVYL 291


>gi|188581592|ref|YP_001925037.1| methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor
           [Methylobacterium populi BJ001]
 gi|179345090|gb|ACB80502.1| methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor
           [Methylobacterium populi BJ001]
          Length = 654

 Score = 34.8 bits (79), Expect = 7.0,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 26/53 (49%), Gaps = 4/53 (7%)

Query: 141 KHSCKVIDISESGV--SVSVDLQIEMFSKVLFND--ILGRVVRIFPGGIAIEF 189
           +  C V+++SE G   +V      E+F+  +  +     R++R    GI ++F
Sbjct: 601 RRPCTVLNLSEGGAKLAVEAAGLPEVFTLHVDGEPPRRCRLMRRTEDGIGVQF 653


>gi|134291885|ref|YP_001115654.1| cellulose synthase (UDP-forming) [Burkholderia vietnamiensis G4]
 gi|134135074|gb|ABO59399.1| Cellulose synthase (UDP-forming) [Burkholderia vietnamiensis G4]
          Length = 733

 Score = 34.8 bits (79), Expect = 7.5,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 26/71 (36%), Gaps = 9/71 (12%)

Query: 107 ANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISES--GVSVSVDLQIEM 164
           AN+     +  R   R           L   +    +C+ +D SE   GV+V  D ++  
Sbjct: 567 ANERRQVRESHRVAARIP-------VMLRFGNGRTLACETLDYSEGGIGVAVPEDARVPD 619

Query: 165 FSKVLFNDILG 175
             +V  +   G
Sbjct: 620 GEQVTVSLFRG 630


>gi|85715536|ref|ZP_01046517.1| hypothetical protein NB311A_17564 [Nitrobacter sp. Nb-311A]
 gi|85697731|gb|EAQ35607.1| hypothetical protein NB311A_17564 [Nitrobacter sp. Nb-311A]
          Length = 105

 Score = 34.8 bits (79), Expect = 7.6,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 29/84 (34%), Gaps = 10/84 (11%)

Query: 115 QDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDIL 174
           +D R + R    +    +           C++++ S  G ++ V     + S+       
Sbjct: 13  EDRRKHPRVEIDEPAYIS----TGGLSMRCRLLNASPQGAALEVPNPAVVPSRFQLMTEK 68

Query: 175 GRVVR------IFPGGIAIEFSSV 192
            RV+R      I    I I F S 
Sbjct: 69  DRVIRPCRVIWIKQNRIGISFDSP 92


>gi|218530612|ref|YP_002421428.1| methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor
           [Methylobacterium chloromethanicum CM4]
 gi|218522915|gb|ACK83500.1| methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor
           [Methylobacterium chloromethanicum CM4]
          Length = 654

 Score = 34.8 bits (79), Expect = 7.7,   Method: Composition-based stats.
 Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 4/54 (7%)

Query: 141 KHSCKVIDISESGV--SVSVDLQIEMFSKVLFN--DILGRVVRIFPGGIAIEFS 190
              C ++++SE G   ++       + +  +        RV+R    GI ++F 
Sbjct: 601 SRPCTILNLSEGGAKLALEAADLPNLVTLHIDGEPSRPCRVIRRAADGIGVQFV 654


>gi|327480595|gb|AEA83905.1| glutathione S-transferase domain-containing protein [Pseudomonas
           stutzeri DSM 4166]
          Length = 334

 Score = 34.8 bits (79), Expect = 7.8,   Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 43/117 (36%), Gaps = 13/117 (11%)

Query: 4   GIHNLQFIDQRAFQRVKVDLKGRFLLF---DGTEYNCIVREISPGGLCIVCDVPMFLVGE 60
            + +L+F+ QR + R   D  GR  +    D  E  CIV   S   + I+      + G 
Sbjct: 106 ALDDLEFLHQR-YTRDDSDYSGRVTVPVLWDR-ERQCIVNNESAEIIRILNTAFDGITGS 163

Query: 61  RSIVFVEKV-GRIEGKVVNFDS-------NRGYAVRIVTSENERRKLADKLIWLANK 109
           R   + E + G I+                 G+A      E    +L  +L W+  +
Sbjct: 164 RLDFYPEPLRGEIDALNARIYPAINNGVYRAGFATTQDAYEEAFDELFRELDWVERR 220


>gi|257142099|ref|ZP_05590361.1| glycosyl transferase, group 2 family protein [Burkholderia
           thailandensis E264]
          Length = 860

 Score = 34.8 bits (79), Expect = 7.8,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 22/50 (44%), Gaps = 1/50 (2%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCI-VCDVPMFLVGERS 62
           R   R+ + +    LL DGT   C  ++ S GGL +    +    +G+  
Sbjct: 709 RVTHRIAMRVPATLLLPDGTTLACRTKDYSAGGLGLDAVPLARIALGDTL 758


>gi|83718202|ref|YP_438994.1| group 2 family glycosyl transferase [Burkholderia thailandensis
           E264]
 gi|83652027|gb|ABC36091.1| glycosyl transferase, group 2 family protein [Burkholderia
           thailandensis E264]
          Length = 845

 Score = 34.8 bits (79), Expect = 7.8,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 22/50 (44%), Gaps = 1/50 (2%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCI-VCDVPMFLVGERS 62
           R   R+ + +    LL DGT   C  ++ S GGL +    +    +G+  
Sbjct: 694 RVTHRIAMRVPATLLLPDGTTLACRTKDYSAGGLGLDAVPLARIALGDTL 743


>gi|115351316|ref|YP_773155.1| cellulose synthase [Burkholderia ambifaria AMMD]
 gi|115281304|gb|ABI86821.1| Cellulose synthase (UDP-forming) [Burkholderia ambifaria AMMD]
          Length = 845

 Score = 34.8 bits (79), Expect = 7.8,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 29/74 (39%), Gaps = 10/74 (13%)

Query: 129 EVDAQLVLNDNTKHSCKVIDISESGVSVSV--DLQIEMFSKVLFNDILG--------RVV 178
            V A L+L D +  +C   D S  G+ +     L + +   +      G        RV 
Sbjct: 702 RVPATLLLADGSTAACFTSDYSTGGLGLEAVPGLPLAIGDTLTVCVTRGDRPFPFPVRVS 761

Query: 179 RIFPGGIAIEFSSV 192
           R+ P  + + F ++
Sbjct: 762 RVTPTHVGVSFEAL 775


>gi|294663986|ref|ZP_06729402.1| celullose synthase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|292606240|gb|EFF49475.1| celullose synthase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
          Length = 731

 Score = 34.8 bits (79), Expect = 7.9,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 41/117 (35%), Gaps = 15/117 (12%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVP-MFLVGERSIVFVEKVGRI 72
           R+  RV +D+     L DG          S GG+ I+   P     G    + +   G +
Sbjct: 579 RSAHRVPLDVPVTLYLPDGGVLPSRSVNFSTGGMAIMLAQPQPIEPGLPVQIGLSHRG-V 637

Query: 73  EGK---VVNFDSNRGYAVRIVTSENERRKLADKLIWL----ANKDDLHLQDCRAYGR 122
           E     VV  D +   +++      E+ +      WL      + D+ L     + R
Sbjct: 638 EQTLPAVVRQDRDGQVSIQFTQMSMEQER------WLVASTFARADIWLSQWGQHDR 688


>gi|254245680|ref|ZP_04939001.1| Glycosyl transferase [Burkholderia cenocepacia PC184]
 gi|124870456|gb|EAY62172.1| Glycosyl transferase [Burkholderia cenocepacia PC184]
          Length = 585

 Score = 34.8 bits (79), Expect = 8.1,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 29/74 (39%), Gaps = 10/74 (13%)

Query: 129 EVDAQLVLNDNTKHSCKVIDISESGVSVSV--DLQIEMFSKVLFNDILG--------RVV 178
            V A L+L D +  +C   D S  G+ +     L + +   +      G        RV 
Sbjct: 442 RVPAMLLLADGSTAACFTSDYSTGGLGLEAVPGLPLAVGDTLTVCVTRGDRAFPFPVRVT 501

Query: 179 RIFPGGIAIEFSSV 192
           R+ P  + + F ++
Sbjct: 502 RVTPTHVGVSFEAL 515


>gi|312199354|ref|YP_004019415.1| L-carnitine dehydratase/bile acid-inducible protein F [Frankia sp.
           EuI1c]
 gi|311230690|gb|ADP83545.1| L-carnitine dehydratase/bile acid-inducible protein F [Frankia sp.
           EuI1c]
          Length = 830

 Score = 34.4 bits (78), Expect = 8.3,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 32/79 (40%), Gaps = 7/79 (8%)

Query: 29  LFD--GTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIE--GKVVNFDSNRG 84
           L D    +  C +  +   G  +  D  +  +G+     V+ VG++E  G +V    N G
Sbjct: 733 LPDFEKRDLPCELS-VDTFGAALFTDPALRRLGDVVTAQVDGVGKLEQTGVLVRLTENPG 791

Query: 85  YAVR--IVTSENERRKLAD 101
                  +  E+ R  LA+
Sbjct: 792 VVAGPPCLAGEHSRDILAE 810


>gi|330501994|ref|YP_004378863.1| type IV pilus assembly PilZ [Pseudomonas mendocina NK-01]
 gi|328916280|gb|AEB57111.1| type IV pilus assembly PilZ [Pseudomonas mendocina NK-01]
          Length = 387

 Score = 34.4 bits (78), Expect = 8.4,   Method: Composition-based stats.
 Identities = 11/48 (22%), Positives = 21/48 (43%)

Query: 13 QRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE 60
          QR   RVK+  + R+        +  ++++S GG     +     VG+
Sbjct: 16 QRQHARVKLPGRLRYTNAQRERIDARLQDVSAGGFSFTSENATHKVGD 63


>gi|257460589|ref|ZP_05625690.1| riboflavin synthase, alpha subunit [Campylobacter gracilis RM3268]
 gi|257441920|gb|EEV17062.1| riboflavin synthase, alpha subunit [Campylobacter gracilis RM3268]
          Length = 284

 Score = 34.4 bits (78), Expect = 8.4,   Method: Composition-based stats.
 Identities = 12/47 (25%), Positives = 20/47 (42%)

Query: 156 VSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSL 202
           +    +  +   V  N     V R+F  G A++ SS     IA ++L
Sbjct: 22  LRAKYRPALGDSVAVNGACLSVTRLFADGFAVQLSSETARVIAVQNL 68


>gi|22001530|sp|P58932|BCSA_XANAC RecName: Full=Cellulose synthase catalytic subunit [UDP-forming]
 gi|21109886|gb|AAM38361.1| celullose synthase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 729

 Score = 34.4 bits (78), Expect = 8.4,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 41/117 (35%), Gaps = 15/117 (12%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVP-MFLVGERSIVFVEKVGRI 72
           R+  RV +D+     L DG          S GG+ I+   P     G    + +   G +
Sbjct: 577 RSAHRVPLDVPVTLYLPDGDVLPSRSVNFSTGGMAIMLAQPQPIEPGLPVQIGLSHRG-V 635

Query: 73  EGK---VVNFDSNRGYAVRIVTSENERRKLADKLIWL----ANKDDLHLQDCRAYGR 122
           E     VV  D +   +++      E+ +      WL      + D+ L     + R
Sbjct: 636 EQTLPAVVRQDRDGQVSIQFTQMSMEQER------WLVASTFARADIWLSQWGQHDR 686


>gi|15643667|ref|NP_228713.1| hypothetical protein TM0905 [Thermotoga maritima MSB8]
 gi|4981441|gb|AAD35986.1|AE001755_9 hypothetical protein TM_0905 [Thermotoga maritima MSB8]
          Length = 229

 Score = 34.4 bits (78), Expect = 8.4,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 4/58 (6%)

Query: 8   LQFIDQRAFQRVKVDLKGRFLLFDGTEYNCI--VREISPGGLCIVCDVPMFLVGERSI 63
           L+ I +R F+R+K+ L+G + +    E       R+ S GG+ +V  V   L  E+ I
Sbjct: 106 LRKIQRRRFKRIKIFLEGTYRVASRDEPPKRFVTRDFSAGGMLMV--VEDILTPEQII 161


>gi|170703653|ref|ZP_02894389.1| cellulose synthase catalytic subunit (UDP-forming) [Burkholderia
           ambifaria IOP40-10]
 gi|170131441|gb|EDT00033.1| cellulose synthase catalytic subunit (UDP-forming) [Burkholderia
           ambifaria IOP40-10]
          Length = 845

 Score = 34.4 bits (78), Expect = 8.6,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 29/74 (39%), Gaps = 10/74 (13%)

Query: 129 EVDAQLVLNDNTKHSCKVIDISESGVSVSV--DLQIEMFSKVLFNDILG--------RVV 178
            V A L+L D +  +C   D S  G+ +     L + +   +      G        RV 
Sbjct: 702 RVPATLLLADGSTAACFTSDYSTGGLGLEAVPGLPLAIGDTLTVCVTRGDRPFPFPVRVS 761

Query: 179 RIFPGGIAIEFSSV 192
           R+ P  + + F ++
Sbjct: 762 RVTPTHVGVSFEAL 775


>gi|154250997|ref|YP_001411821.1| trehalose synthase [Parvibaculum lavamentivorans DS-1]
 gi|154154947|gb|ABS62164.1| trehalose synthase [Parvibaculum lavamentivorans DS-1]
          Length = 1061

 Score = 34.4 bits (78), Expect = 8.6,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 11/88 (12%)

Query: 80  DSNRGY-AVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGR-----KITRDREVDAQ 133
           D   G+ AV +   E +R  L   L WL  +     ++ RA+GR         +R+V A 
Sbjct: 428 DPLYGFQAVNVEAQERDRHSL---LNWL-KRMLAVRREHRAFGRGAQRFLRPANRKVLAY 483

Query: 134 LVLNDNTKHSCKVIDISESGVSVSVDLQ 161
           L  +D     C V ++S +  +V +DL 
Sbjct: 484 LREHDGDIILC-VANLSRTAQAVELDLH 510


>gi|77748724|ref|NP_643825.2| celullose synthase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 731

 Score = 34.4 bits (78), Expect = 8.7,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 41/117 (35%), Gaps = 15/117 (12%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVP-MFLVGERSIVFVEKVGRI 72
           R+  RV +D+     L DG          S GG+ I+   P     G    + +   G +
Sbjct: 579 RSAHRVPLDVPVTLYLPDGDVLPSRSVNFSTGGMAIMLAQPQPIEPGLPVQIGLSHRG-V 637

Query: 73  EGK---VVNFDSNRGYAVRIVTSENERRKLADKLIWL----ANKDDLHLQDCRAYGR 122
           E     VV  D +   +++      E+ +      WL      + D+ L     + R
Sbjct: 638 EQTLPAVVRQDRDGQVSIQFTQMSMEQER------WLVASTFARADIWLSQWGQHDR 688


>gi|71278599|ref|YP_268969.1| hypothetical protein CPS_2244 [Colwellia psychrerythraea 34H]
 gi|71144339|gb|AAZ24812.1| conserved hypothetical protein [Colwellia psychrerythraea 34H]
          Length = 99

 Score = 34.4 bits (78), Expect = 8.9,   Method: Composition-based stats.
 Identities = 17/82 (20%), Positives = 32/82 (39%), Gaps = 11/82 (13%)

Query: 113 HLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFN- 171
              D R + R +     +   +    N++ S    D+S +G++  ++  + + + V    
Sbjct: 3   DFDDKRDFYRMMLNSEVIVTVIDDEVNSQLSATCRDLSATGMAFEIEHPLAISTHVKVRV 62

Query: 172 ----------DILGRVVRIFPG 183
                     DI GRVVRI   
Sbjct: 63  DSASSQIQALDIRGRVVRIEEE 84


>gi|171321495|ref|ZP_02910437.1| cellulose synthase catalytic subunit (UDP-forming) [Burkholderia
           ambifaria MEX-5]
 gi|171093223|gb|EDT38429.1| cellulose synthase catalytic subunit (UDP-forming) [Burkholderia
           ambifaria MEX-5]
          Length = 845

 Score = 34.4 bits (78), Expect = 9.1,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 29/74 (39%), Gaps = 10/74 (13%)

Query: 129 EVDAQLVLNDNTKHSCKVIDISESGVSVSV--DLQIEMFSKVLFNDILG--------RVV 178
            V A L+L D +  +C   D S  G+ +     L + +   +      G        RV 
Sbjct: 702 RVPATLLLADGSTAACFTSDYSTGGLGLEAVPGLPLAIGDTLTVCVTRGDRPFPFPVRVS 761

Query: 179 RIFPGGIAIEFSSV 192
           R+ P  + + F ++
Sbjct: 762 RVTPTHVGVSFEAL 775


>gi|167040307|ref|YP_001663292.1| type IV pilus assembly PilZ [Thermoanaerobacter sp. X514]
 gi|300914391|ref|ZP_07131707.1| type IV pilus assembly PilZ [Thermoanaerobacter sp. X561]
 gi|307724373|ref|YP_003904124.1| type IV pilus assembly PilZ [Thermoanaerobacter sp. X513]
 gi|166854547|gb|ABY92956.1| type IV pilus assembly PilZ [Thermoanaerobacter sp. X514]
 gi|300889326|gb|EFK84472.1| type IV pilus assembly PilZ [Thermoanaerobacter sp. X561]
 gi|307581434|gb|ADN54833.1| type IV pilus assembly PilZ [Thermoanaerobacter sp. X513]
          Length = 209

 Score = 34.4 bits (78), Expect = 9.1,   Method: Composition-based stats.
 Identities = 25/107 (23%), Positives = 50/107 (46%), Gaps = 11/107 (10%)

Query: 3   RGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTE---YNCIVREISPGGLCIVCDVPMFLVG 59
             I +++ + +R + R++  +   + +  G E   Y  ++++IS GGL    D     VG
Sbjct: 87  MPISSVERLQRRQYFRLEKVIPFTYTISGGEEDKVYKGLIQDISGGGLRCKVD-KKLEVG 145

Query: 60  ERS--IVFVEKVGRIEGKVVNFDS--NRGYAVRI---VTSENERRKL 99
                +  +++   + GKVV ++    +GY + I     SE  R K+
Sbjct: 146 TIINCVFTLDQEITVSGKVVRYEELLEKGYEIGICYVDISEKVREKI 192


>gi|325526468|gb|EGD04045.1| cellulose synthase (UDP-forming) [Burkholderia sp. TJI49]
          Length = 695

 Score = 34.4 bits (78), Expect = 9.2,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 29/74 (39%), Gaps = 10/74 (13%)

Query: 129 EVDAQLVLNDNTKHSCKVIDISESGVSVSV--DLQIEMFSKVLF----NDI----LGRVV 178
            V A L+L D T  +C   D S  G+ +     L + +   +       D       RV 
Sbjct: 552 RVPATLLLADGTTAACFTSDYSTGGLGLEAVPGLSLAVGDPLTVCVTRGDRSFPFPARVS 611

Query: 179 RIFPGGIAIEFSSV 192
           R+ P  + + F ++
Sbjct: 612 RVTPTHVGLSFDAL 625


>gi|239906453|ref|YP_002953194.1| hypothetical protein DMR_18170 [Desulfovibrio magneticus RS-1]
 gi|239796319|dbj|BAH75308.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 125

 Score = 34.4 bits (78), Expect = 9.2,   Method: Composition-based stats.
 Identities = 14/71 (19%), Positives = 23/71 (32%), Gaps = 9/71 (12%)

Query: 138 DNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFN---------DILGRVVRIFPGGIAIE 188
           D  K      ++S  G     + ++                   +   VVR    G+AI+
Sbjct: 22  DGEKIPVSTQNLSLKGALFCPEPRLAPGRDCTVVFELAKDIKVRLKATVVRSNDEGVAID 81

Query: 189 FSSVQESNIAF 199
           F S+ ES    
Sbjct: 82  FDSMDESAFFH 92


>gi|146282345|ref|YP_001172498.1| glutathione S-transferase domain-containing protein [Pseudomonas
           stutzeri A1501]
 gi|145570550|gb|ABP79656.1| glutathione S-transferase domain protein [Pseudomonas stutzeri
           A1501]
          Length = 334

 Score = 34.4 bits (78), Expect = 9.5,   Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 43/117 (36%), Gaps = 13/117 (11%)

Query: 4   GIHNLQFIDQRAFQRVKVDLKGRFLLF---DGTEYNCIVREISPGGLCIVCDVPMFLVGE 60
            + +L+F+ QR + R   D  GR  +    D  E  CIV   S   + I+      + G 
Sbjct: 106 ALDDLEFLHQR-YTRDDPDYSGRVTVPVLWDR-ERQCIVNNESAEIIRILNTAFDGITGS 163

Query: 61  RSIVFVEKV-GRIEGKVVNFDS-------NRGYAVRIVTSENERRKLADKLIWLANK 109
           R   + E + G I+                 G+A      E    +L  +L W+  +
Sbjct: 164 RLDFYPEPLRGEIDALNARIYPAINNGVYRAGFATTQDAYEEAFDELFRELDWVERR 220


>gi|241206601|ref|YP_002977697.1| AsnC family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860491|gb|ACS58158.1| transcriptional regulator, AsnC family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 145

 Score = 34.4 bits (78), Expect = 9.6,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 41/127 (32%), Gaps = 8/127 (6%)

Query: 14  RAFQRVKVDLKGRFLLFDGTEYNCIVREISPGG----LCIVCDVPMFLVGERSIVFVEKV 69
           R   R+ V                 +  +  GG      I         G R+IV +E +
Sbjct: 16  RHNARISVSSLAAMTGASRATVAARIDRLVAGGIIVGFTIRTGHETRSAGVRAIVMIEVL 75

Query: 70  GRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDRE 129
           G++  +V +          + ++  +   +A+    L ++D     +     R +     
Sbjct: 76  GKLADRVADQLRGLPQVRALHSTNGKWDFIAE----LEDRDLASFDETLRRIRLVNGINS 131

Query: 130 VDAQLVL 136
            +  ++L
Sbjct: 132 TETNILL 138


>gi|323135977|ref|ZP_08071060.1| type IV pilus assembly PilZ [Methylocystis sp. ATCC 49242]
 gi|322399068|gb|EFY01587.1| type IV pilus assembly PilZ [Methylocystis sp. ATCC 49242]
          Length = 99

 Score = 34.4 bits (78), Expect = 9.9,   Method: Composition-based stats.
 Identities = 11/50 (22%), Positives = 17/50 (34%), Gaps = 2/50 (4%)

Query: 142 HSCKVIDISESGVSVSVDLQIEMFSKVLFNDI--LGRVVRIFPGGIAIEF 189
             CKVIDIS  G  +     +     +          V+      + +EF
Sbjct: 42  IPCKVIDISGGGAKLDCQATLPERFTLHVGAAKHAAHVIWRRQTQVGVEF 91


>gi|39998353|ref|NP_954304.1| response regulator [Geobacter sulfurreducens PCA]
 gi|39985299|gb|AAR36654.1| response regulator [Geobacter sulfurreducens PCA]
 gi|298507283|gb|ADI86006.1| response regulator, PilZ domain-containing [Geobacter
           sulfurreducens KN400]
          Length = 231

 Score = 34.4 bits (78), Expect = 10.0,   Method: Composition-based stats.
 Identities = 12/94 (12%), Positives = 26/94 (27%), Gaps = 19/94 (20%)

Query: 121 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFN--------- 171
            R+  R            +T     + DIS  G  ++    +     +            
Sbjct: 125 ERRQPRYPFSALAFFRIRDTSFHGTIADISLGGAYIACRCDLAAKEDIRLGFILDNTAVV 184

Query: 172 DILGRVV----------RIFPGGIAIEFSSVQES 195
           +   RV           +  P G  ++F +++  
Sbjct: 185 ECRARVAWTNQGGMRPRKSLPDGFGVQFQAMEPP 218


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.315    0.155    0.480 

Lambda     K      H
   0.267   0.0475    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,479,540,098
Number of Sequences: 14124377
Number of extensions: 212341625
Number of successful extensions: 661811
Number of sequences better than 10.0: 466
Number of HSP's better than 10.0 without gapping: 238
Number of HSP's successfully gapped in prelim test: 338
Number of HSP's that attempted gapping in prelim test: 660490
Number of HSP's gapped (non-prelim): 853
length of query: 207
length of database: 4,842,793,630
effective HSP length: 133
effective length of query: 74
effective length of database: 2,964,251,489
effective search space: 219354610186
effective search space used: 219354610186
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (20.9 bits)
S2: 78 (34.4 bits)