RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780885|ref|YP_003065298.1| hypothetical protein CLIBASIA_03910 [Candidatus Liberibacter asiaticus str. psy62] (207 letters) >gnl|CDD|36362 KOG1147, KOG1147, KOG1147, Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 712 Score = 30.3 bits (68), Expect = 0.38 Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Query: 93 ENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDR---EVDAQLVLNDNTKHSCKVI 147 + + +K KL WLA+ +D D + IT+D+ + D + +N NT ++ Sbjct: 602 DGDFKKTKLKLTWLADTNDSVPVDLVDFDHLITKDKLEKDEDFKDFVNPNTVKETLML 659 >gnl|CDD|144696 pfam01196, Ribosomal_L17, Ribosomal protein L17. Length = 97 Score = 30.1 bits (69), Expect = 0.42 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Query: 88 RIVTSEN---ERRKLADKLIWLANKDDLH 113 RI T+ E R A+KLI LA K DLH Sbjct: 14 RIETTLAKAKELRPYAEKLITLAKKGDLH 42 >gnl|CDD|30552 COG0203, RplQ, Ribosomal protein L17 [Translation, ribosomal structure and biogenesis]. Length = 116 Score = 29.0 bits (65), Expect = 0.89 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 6/51 (11%) Query: 88 RIVTSE---NERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLV 135 RI T+ E R++ +KLI LA K DL R RD++ +L Sbjct: 33 RIETTLPKAKELRRVVEKLITLAKKGDLA---NRRLAFARLRDKDAVKKLF 80 >gnl|CDD|31135 COG0792, COG0792, Predicted endonuclease distantly related to archaeal Holliday junction resolvase [DNA replication, recombination, and repair]. Length = 114 Score = 28.3 bits (63), Expect = 1.4 Identities = 18/61 (29%), Positives = 25/61 (40%), Gaps = 11/61 (18%) Query: 60 ERSIVFVEKVGRIEGKVVNFDSNR--GYAVRIVTSENERRKLADKLIWLANKDDLHLQDC 117 ++VFVE V + N G A VT +R+ +WLA + DL C Sbjct: 42 GDTVVFVE---------VKYRRNDLYGGAAEAVTPRKQRKLRRAARLWLARQPDLSDLPC 92 Query: 118 R 118 R Sbjct: 93 R 93 >gnl|CDD|173841 cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position. Length = 380 Score = 26.9 bits (60), Expect = 4.3 Identities = 12/54 (22%), Positives = 17/54 (31%) Query: 82 NRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLV 135 N G+ V + T ER + L GR + D V +L Sbjct: 226 NDGWKVAMTTLNFERVSIGGSAATFFELLLARLLLLTRDGRPLIDDPLVRQRLA 279 >gnl|CDD|33853 COG4096, HsdR, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]. Length = 875 Score = 26.5 bits (58), Expect = 4.8 Identities = 20/72 (27%), Positives = 29/72 (40%), Gaps = 8/72 (11%) Query: 119 AYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVD--------LQIEMFSKVLF 170 Y KIT D E L+ N K I I+ ++ VD ++ SK F Sbjct: 456 RYAMKITGDAEQAQALIDNFIDKEKYPRIAITVDLLTTGVDVPEVVNLVFDRKVRSKTKF 515 Query: 171 NDILGRVVRIFP 182 ++GR R+ P Sbjct: 516 KQMVGRGTRLCP 527 >gnl|CDD|33884 COG4127, COG4127, Uncharacterized conserved protein [Function unknown]. Length = 318 Score = 26.5 bits (58), Expect = 5.4 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 10/58 (17%) Query: 65 FVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLI-------WLAN---KDDL 112 FV ++ + + + SNR Y + VTS+ E + I WLA +DD Sbjct: 69 FVNEIQKGDLVITYSKSNRTYLIGKVTSDYEYHPEWLEGIGHTRKVKWLAKEIPRDDF 126 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.326 0.142 0.418 Gapped Lambda K H 0.267 0.0759 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,449,410 Number of extensions: 125758 Number of successful extensions: 325 Number of sequences better than 10.0: 1 Number of HSP's gapped: 325 Number of HSP's successfully gapped: 15 Length of query: 207 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 118 Effective length of database: 4,340,536 Effective search space: 512183248 Effective search space used: 512183248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 55 (24.9 bits)