RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780885|ref|YP_003065298.1| hypothetical protein CLIBASIA_03910 [Candidatus Liberibacter asiaticus str. psy62] (207 letters) >1ywu_A Hypothetical protein PA4608; PAT7, beta barrel, PILZ domain, structural genomics, PSI, protein structure initiative; NMR {Pseudomonas aeruginosa PAO1} (A:) Length = 149 Score = 53.8 bits (129), Expect = 2e-08 Identities = 15/114 (13%), Positives = 37/114 (32%), Gaps = 8/114 (7%) Query: 8 LQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFL-VGERSIVFV 66 Q ++R F R+ D +L + ++ ++S G+ + + Sbjct: 25 DQHDERRRFHRIAFDADSE-ILQGERRWEVLLHDVSLHGILVGQPQDWNGDPQRPFEARL 83 Query: 67 ----EKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQD 116 + + R+E + + + + +L+ L N D L + Sbjct: 84 YLGLDVLIRMEISLAWAR-DGLLGFECQHIDLDSISHLRRLVEL-NLGDEELLE 135 Score = 35.7 bits (82), Expect = 0.005 Identities = 9/74 (12%), Positives = 23/74 (31%), Gaps = 13/74 (17%) Query: 138 DNTKHSCKVIDISESGVSVS------------VDLQIEMFSKVLFNDILGRVVRIFPGGI 185 + + D+S G+ V + ++ + VL + + G + Sbjct: 47 GERRWEVLLHDVSLHGILVGQPQDWNGDPQRPFEARLYLGLDVLI-RMEISLAWARDGLL 105 Query: 186 AIEFSSVQESNIAF 199 E + +I+ Sbjct: 106 GFECQHIDLDSISH 119 >3cnr_A Type IV fimbriae assembly protein; PILZ, xanthomonas citri, type IV pilus assembly, unknown function; HET: MSE; 1.90A {Xanthomonas axonopodis PV} PDB: 3dsg_A (A:) Length = 117 Score = 32.6 bits (74), Expect = 0.042 Identities = 11/95 (11%), Positives = 24/95 (25%), Gaps = 14/95 (14%) Query: 15 AFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVG---- 70 A + L Y+ + GG+ + + +G+ + + Sbjct: 3 AXNARQGILSLALKD-KPALYSAYXPFVKGGGIFVPTPKR-YXLGDEVFLLLTLPDSSER 60 Query: 71 -RIEGKVVNFDSNR-------GYAVRIVTSENERR 97 + GKV+ G V+ Sbjct: 61 LPVAGKVIWTTPAGAQGNRAAGIGVQFPDGPEGEA 95 >2rde_A Uncharacterized protein VCA0042; C-DI-GMP, structural genomics, PSI-2, protein structure initiative; HET: C2E; 1.92A {Vibrio cholerae O395} (A:138-251) Length = 114 Score = 29.8 bits (67), Expect = 0.28 Identities = 19/100 (19%), Positives = 38/100 (38%), Gaps = 14/100 (14%) Query: 18 RVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDV--PMFLVGERSIVFVE-------K 68 R +++L G+ +LFD +C +R++S G + + VG+ + + Sbjct: 2 RFELNLAGK-VLFDEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKT 60 Query: 69 VGRIEGKVVN-FDSNRGYAVRIV---TSENERRKLADKLI 104 + GK+ N S + N + L +L Sbjct: 61 FPPLTGKICNLQRSLHHARYGLEFNEEGRNNAKNLLAQLK 100 Score = 28.3 bits (63), Expect = 0.70 Identities = 13/96 (13%), Positives = 39/96 (40%), Gaps = 22/96 (22%) Query: 129 EVDAQLVLNDNTKHSCKVIDISESGV---------------SVSVDLQIEMFSKVLFNDI 173 + +++ +++ + C++ D+S SG V++++ ++ F + Sbjct: 6 NLAGKVLFDEH-RGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPL 64 Query: 174 LGRVVRIFPGG----IAIEFSSVQESNIAFKSLINH 205 G++ + +EF+ +N K+L+ Sbjct: 65 TGKICNLQRSLHHARYGLEFNEEGRNNA--KNLLAQ 98 >2cqm_A Ribosomal protein L17 isolog; alpha and beta (A+B), structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} (A:) Length = 122 Score = 28.6 bits (64), Expect = 0.61 Identities = 11/46 (23%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Query: 88 RIVTSEN---ERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREV 130 RI E R A+KLI D + + R +T + Sbjct: 21 RIEAPWARVDEMRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLI 66 >2c35_B Human RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transcription, nucleotidyltransferase; 2.70A {Homo sapiens} (B:81-172) Length = 92 Score = 28.2 bits (63), Expect = 0.79 Identities = 8/66 (12%), Positives = 17/66 (25%) Query: 19 VKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVN 78 +V+ G F I P + +++ I K+V Sbjct: 10 TQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVG 69 Query: 79 FDSNRG 84 ++ Sbjct: 70 TRVDKN 75 >2gjg_A Hypothetical protein PP4397; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; 2.25A {Pseudomonas putida KT2440} (A:124-248) Length = 125 Score = 27.6 bits (61), Expect = 1.4 Identities = 12/106 (11%), Positives = 27/106 (25%), Gaps = 20/106 (18%) Query: 14 RAFQRVKVDLKGRFLLF-------DGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFV 66 R R + L + + +IS G + + + + V+ Sbjct: 1 RNAFRAALKLSQLVDIILDGAHLKGNGAXRGKLLDISATGCKLRFEGNVEDRLQLGQVYE 60 Query: 67 -------EKVGRIEGKVVNFDSNRG-----YAVRIVT-SENERRKL 99 + ++ + VR S +RK+ Sbjct: 61 RFKAGNPLGLVDTXVELRHLHYEERINTTFAGVRFHNLSGQAQRKI 106 >3bbo_P Ribosomal protein L17; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Nicotiana tabacum} (P:) Length = 205 Score = 26.9 bits (59), Expect = 2.1 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Query: 88 RIVTSEN---ERRKLADKLIWLANKDDLH 113 RI T++ RK DK+I +A LH Sbjct: 122 RIKTTKARARAVRKYVDKMITMAKDGSLH 150 >3fov_A UPF0102 protein RPA0323; structural genomics, APC7380, PSI-2, protein structure initiative; 1.88A {Rhodopseudomonas palustris CGA009} (A:) Length = 134 Score = 25.6 bits (56), Expect = 4.8 Identities = 13/71 (18%), Positives = 23/71 (32%), Gaps = 9/71 (12%) Query: 48 CIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLA 107 ++ + + + FVE V N A VT + R +A WL+ Sbjct: 48 TRCGEIDLVAQRDALVAFVE---------VKARGNVDDAAYAVTPRQQSRIVAAAEAWLS 98 Query: 108 NKDDLHLQDCR 118 + + R Sbjct: 99 RHPEHAXSELR 109 >2zjr_K 50S ribosomal protein L17; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} (K:) Length = 116 Score = 25.5 bits (56), Expect = 5.6 Identities = 11/29 (37%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Query: 88 RIVTSEN---ERRKLADKLIWLANKDDLH 113 RI T+ E R ++LI A DLH Sbjct: 33 RIQTTLTKAKELRPFVEQLITTAKGGDLH 61 >3i1n_N 50S ribosomal protein L17; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1p85_L 1p86_L 1vs8_N 2aw4_N 2awb_N 1vs6_N 2i2v_N 2j28_N 2i2t_N* 2qao_N* 2qba_N* 2qbc_N* 2qbe_N 2qbg_N 2qbi_N* 2qbk_N* 2qov_N 2qox_N 2qoz_N* 2qp1_N* ... (N:) Length = 127 Score = 25.1 bits (55), Expect = 6.7 Identities = 9/29 (31%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Query: 88 RIVTSEN---ERRKLADKLIWLANKDDLH 113 I T+ E R++ + LI LA D + Sbjct: 33 IIKTTLPKAKELRRVVEPLITLAKTDSVA 61 >1gd8_A 50S ribosomal protein L17; two domains, ribosomal protein S8-like domain, Trp repressor-like domain, helix-turn-helix motif; 2.30A {Thermus thermophilus} (A:) Length = 118 Score = 25.2 bits (55), Expect = 7.3 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Query: 88 RIVTSEN---ERRKLADKLIWLANKDDLH 113 RI T+ E R D LI LA + DLH Sbjct: 33 RITTTVPKAKELRGFVDHLIHLAKRGDLH 61 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.326 0.142 0.418 Gapped Lambda K H 0.267 0.0580 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,553,687 Number of extensions: 67560 Number of successful extensions: 192 Number of sequences better than 10.0: 1 Number of HSP's gapped: 190 Number of HSP's successfully gapped: 19 Length of query: 207 Length of database: 4,956,049 Length adjustment: 84 Effective length of query: 123 Effective length of database: 2,116,429 Effective search space: 260320767 Effective search space used: 260320767 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.1 bits)