RPSBLAST alignment of GI: 254780885 and protein with PDBid: 1ywu

>1ywu_A Hypothetical protein PA4608; PAT7, beta barrel, PILZ domain, structural genomics, PSI, protein structure initiative; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.45.2.1 Length = 149
 Score = 36.5 bits (84), Expect = 0.004
 Identities = 16/118 (13%), Positives = 40/118 (33%), Gaps = 8/118 (6%)

Query: 2   YRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFL-VGE 60
           ++G  + Q  ++R F R+  D     +L     +  ++ ++S  G+ +            
Sbjct: 19  FQGHMSDQHDERRRFHRIAFDADSE-ILQGERRWEVLLHDVSLHGILVGQPQDWNGDPQR 77

Query: 61  RSIVFV----EKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHL 114
                +    + + R+E  +     +          + +      +L+ L N  D  L
Sbjct: 78  PFEARLYLGLDVLIRMEISLAWAR-DGLLGFECQHIDLDSISHLRRLVEL-NLGDEEL 133