BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780885|ref|YP_003065298.1| hypothetical protein CLIBASIA_03910 [Candidatus Liberibacter asiaticus str. psy62] (207 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780885|ref|YP_003065298.1| hypothetical protein CLIBASIA_03910 [Candidatus Liberibacter asiaticus str. psy62] Length = 207 Score = 420 bits (1080), Expect = e-120, Method: Compositional matrix adjust. Identities = 207/207 (100%), Positives = 207/207 (100%) Query: 1 MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE 60 MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE Sbjct: 1 MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE 60 Query: 61 RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAY 120 RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAY Sbjct: 61 RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAY 120 Query: 121 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI 180 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI Sbjct: 121 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI 180 Query: 181 FPGGIAIEFSSVQESNIAFKSLINHCY 207 FPGGIAIEFSSVQESNIAFKSLINHCY Sbjct: 181 FPGGIAIEFSSVQESNIAFKSLINHCY 207 >gi|254780456|ref|YP_003064869.1| 30S ribosomal protein S1 [Candidatus Liberibacter asiaticus str. psy62] Length = 576 Score = 25.4 bits (54), Expect = 0.78, Method: Compositional matrix adjust. Identities = 13/29 (44%), Positives = 18/29 (62%) Query: 130 VDAQLVLNDNTKHSCKVIDISESGVSVSV 158 VD+ L N SC+VI +SE G+ VS+ Sbjct: 450 VDSVSSLRKNDVVSCEVISVSEGGIEVSL 478 >gi|254781097|ref|YP_003065510.1| N-acetylglucosaminyl transferase [Candidatus Liberibacter asiaticus str. psy62] Length = 369 Score = 23.1 bits (48), Expect = 4.1, Method: Compositional matrix adjust. Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 82 NRGYAVRIVTSENERRKLAD 101 NRGYAV ++T R + D Sbjct: 30 NRGYAVYLITDRRARSFITD 49 >gi|254780524|ref|YP_003064937.1| flagellar hook-associated protein FlgK [Candidatus Liberibacter asiaticus str. psy62] Length = 480 Score = 21.9 bits (45), Expect = 8.5, Method: Compositional matrix adjust. Identities = 22/92 (23%), Positives = 41/92 (44%), Gaps = 14/92 (15%) Query: 87 VRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKV 146 V +VT +E + + DK+ LH +++ + E +++ D+ ++ Sbjct: 50 VTVVTQRSENKNMFDKV--------LHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPT 101 Query: 147 IDISESGVSVSVDLQIEMFSKVLFNDILGRVV 178 IS+ S +E +SK L DILG+ V Sbjct: 102 HYISKLRDS------LESYSKNLSEDILGKTV 127 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.326 0.142 0.418 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 133,174 Number of Sequences: 1233 Number of extensions: 5526 Number of successful extensions: 20 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 6 length of query: 207 length of database: 328,796 effective HSP length: 70 effective length of query: 137 effective length of database: 242,486 effective search space: 33220582 effective search space used: 33220582 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 36 (18.5 bits)