BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780886|ref|YP_003065299.1| hypothetical protein
CLIBASIA_03915 [Candidatus Liberibacter asiaticus str. psy62]
         (41 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780886|ref|YP_003065299.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040563|gb|ACT57359.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 41

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/41 (100%), Positives = 41/41 (100%)

Query: 1  MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41
          MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ
Sbjct: 1  MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41


>gi|254781005|ref|YP_003065418.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040682|gb|ACT57478.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 85

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 31/41 (75%)

Query: 1  MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41
          M+ KGLIVAS+ISST IMS CS + + ++ IR++   +K++
Sbjct: 1  MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQE 41


Searching..................................................done


Results from round 2





CONVERGED!
>gi|254780886|ref|YP_003065299.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040563|gb|ACT57359.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 41

 Score = 60.6 bits (145), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 41/41 (100%), Positives = 41/41 (100%)

Query: 1  MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41
          MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ
Sbjct: 1  MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41


>gi|254781005|ref|YP_003065418.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040682|gb|ACT57478.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 85

 Score = 43.2 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 20/41 (48%), Positives = 31/41 (75%)

Query: 1  MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41
          M+ KGLIVAS+ISST IMS CS + + ++ IR++   +K++
Sbjct: 1  MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQE 41


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.318    0.125    0.343 

Lambda     K      H
   0.267   0.0418    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 650,654,164
Number of Sequences: 14124377
Number of extensions: 11445479
Number of successful extensions: 27887
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 27883
Number of HSP's gapped (non-prelim): 4
length of query: 41
length of database: 4,842,793,630
effective HSP length: 15
effective length of query: 26
effective length of database: 4,630,927,975
effective search space: 120404127350
effective search space used: 120404127350
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 76 (33.9 bits)