BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780886|ref|YP_003065299.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter asiaticus str. psy62] (41 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254780886|ref|YP_003065299.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter asiaticus str. psy62] gi|254040563|gb|ACT57359.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter asiaticus str. psy62] Length = 41 Score = 81.3 bits (199), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 41/41 (100%), Positives = 41/41 (100%) Query: 1 MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41 MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ Sbjct: 1 MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41 >gi|254781005|ref|YP_003065418.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62] gi|254040682|gb|ACT57478.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 44.7 bits (104), Expect = 0.004, Method: Compositional matrix adjust. Identities = 20/41 (48%), Positives = 31/41 (75%) Query: 1 MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41 M+ KGLIVAS+ISST IMS CS + + ++ IR++ +K++ Sbjct: 1 MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQE 41 Searching..................................................done Results from round 2 CONVERGED! >gi|254780886|ref|YP_003065299.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter asiaticus str. psy62] gi|254040563|gb|ACT57359.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter asiaticus str. psy62] Length = 41 Score = 60.6 bits (145), Expect = 6e-08, Method: Composition-based stats. Identities = 41/41 (100%), Positives = 41/41 (100%) Query: 1 MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41 MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ Sbjct: 1 MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41 >gi|254781005|ref|YP_003065418.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62] gi|254040682|gb|ACT57478.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 43.2 bits (100), Expect = 0.011, Method: Composition-based stats. Identities = 20/41 (48%), Positives = 31/41 (75%) Query: 1 MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41 M+ KGLIVAS+ISST IMS CS + + ++ IR++ +K++ Sbjct: 1 MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQE 41 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.318 0.125 0.343 Lambda K H 0.267 0.0418 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 650,654,164 Number of Sequences: 14124377 Number of extensions: 11445479 Number of successful extensions: 27887 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 27883 Number of HSP's gapped (non-prelim): 4 length of query: 41 length of database: 4,842,793,630 effective HSP length: 15 effective length of query: 26 effective length of database: 4,630,927,975 effective search space: 120404127350 effective search space used: 120404127350 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 76 (33.9 bits)