BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780886|ref|YP_003065299.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter asiaticus str. psy62] (41 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780886|ref|YP_003065299.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter asiaticus str. psy62] Length = 41 Score = 81.3 bits (199), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 41/41 (100%), Positives = 41/41 (100%) Query: 1 MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41 MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ Sbjct: 1 MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41 >gi|254781005|ref|YP_003065418.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 44.7 bits (104), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 20/41 (48%), Positives = 31/41 (75%) Query: 1 MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41 M+ KGLIVAS+ISST IMS CS + + ++ IR++ +K++ Sbjct: 1 MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQE 41 >537021.9.peg.60_1 Length = 44 Score = 26.6 bits (57), Expect = 0.074, Method: Compositional matrix adjust. Identities = 14/30 (46%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Query: 1 MNAKGLIVASIISSTAIMSSC-SYSWNLKH 29 +N K L++ S++SSTAI+S C S+S + H Sbjct: 15 VNIKKLLIVSLLSSTAIISGCDSHSGDGVH 44 >gi|254780619|ref|YP_003065032.1| primosome assembly protein PriA [Candidatus Liberibacter asiaticus str. psy62] Length = 731 Score = 23.9 bits (50), Expect = 0.56, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 5 GLIVASIISSTAIMSSCSYSWNLK-HAIRKIEIAI 38 G + A IIS T +Y++NLK HA R +I + Sbjct: 638 GRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.125 0.343 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,494 Number of Sequences: 1233 Number of extensions: 377 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 41 length of database: 328,796 effective HSP length: 15 effective length of query: 26 effective length of database: 310,301 effective search space: 8067826 effective search space used: 8067826 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.9 bits) S2: 31 (16.5 bits)