BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780887|ref|YP_003065300.1| hypothetical protein CLIBASIA_03920 [Candidatus Liberibacter asiaticus str. psy62] (86 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780887|ref|YP_003065300.1| hypothetical protein CLIBASIA_03920 [Candidatus Liberibacter asiaticus str. psy62] Length = 86 Score = 175 bits (444), Expect = 1e-46, Method: Compositional matrix adjust. Identities = 86/86 (100%), Positives = 86/86 (100%) Query: 1 MSKVEKKILKVGSMGITRIRFEMGLRHKNHPKKALKPSCNLSTIIPQTVSFELINNLNYS 60 MSKVEKKILKVGSMGITRIRFEMGLRHKNHPKKALKPSCNLSTIIPQTVSFELINNLNYS Sbjct: 1 MSKVEKKILKVGSMGITRIRFEMGLRHKNHPKKALKPSCNLSTIIPQTVSFELINNLNYS 60 Query: 61 VSTNDKPFTYPSRGASSSDLPIKGLI 86 VSTNDKPFTYPSRGASSSDLPIKGLI Sbjct: 61 VSTNDKPFTYPSRGASSSDLPIKGLI 86 >gi|254780970|ref|YP_003065383.1| phosphoribosylformylglycinamidine synthase II [Candidatus Liberibacter asiaticus str. psy62] Length = 737 Score = 26.9 bits (58), Expect = 0.057, Method: Compositional matrix adjust. Identities = 12/26 (46%), Positives = 16/26 (61%) Query: 60 SVSTNDKPFTYPSRGASSSDLPIKGL 85 ++TNDK F RG ++LPIK L Sbjct: 342 GITTNDKLFRVIHRGEEVANLPIKAL 367 >gi|254780451|ref|YP_003064864.1| aconitate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 896 Score = 26.2 bits (56), Expect = 0.11, Method: Compositional matrix adjust. Identities = 11/37 (29%), Positives = 19/37 (51%) Query: 33 KALKPSCNLSTIIPQTVSFELINNLNYSVSTNDKPFT 69 +A C +S ++P+ V FE+ +L V+ D T Sbjct: 237 EAAMLGCPISMLLPEVVGFEVTGSLQEGVTATDLVLT 273 >gi|254780419|ref|YP_003064832.1| aspartyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 622 Score = 24.6 bits (52), Expect = 0.34, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Query: 13 SMGITRIRFEMGLRHKNHPKKALKPSCNLSTIIPQTVSFELINNL 57 ++ + ++R E+GLR +PKK LK S ++TI+ ++I+++ Sbjct: 578 TVSVEQLR-ELGLRIVENPKKILKIS--VTTILRNVYGLKIIHSI 619 Score = 20.4 bits (41), Expect = 5.2, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 5/58 (8%) Query: 13 SMGITRIRFEMGLRHKNHPKKALKPS----CNLSTIIPQTVSFELINNLNYSVSTNDK 66 + GI RI + L KN + +L P C+L P TVS E + L + N K Sbjct: 540 AAGIDRIVMLL-LGAKNVREVSLFPMSQNFCDLLMGSPSTVSVEQLRELGLRIVENPK 596 >gi|254780955|ref|YP_003065368.1| hypothetical protein CLIBASIA_04270 [Candidatus Liberibacter asiaticus str. psy62] Length = 204 Score = 23.5 bits (49), Expect = 0.65, Method: Compositional matrix adjust. Identities = 11/34 (32%), Positives = 18/34 (52%) Query: 20 RFEMGLRHKNHPKKALKPSCNLSTIIPQTVSFEL 53 FE+GL N P++ + P + +V+FEL Sbjct: 105 HFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFEL 138 >gi|255764471|ref|YP_003064835.2| GTP-binding protein EngA [Candidatus Liberibacter asiaticus str. psy62] Length = 470 Score = 20.8 bits (42), Expect = 5.1, Method: Compositional matrix adjust. Identities = 9/25 (36%), Positives = 12/25 (48%) Query: 7 KILKVGSMGITRIRFEMGLRHKNHP 31 ++L GITR + KNHP Sbjct: 228 RLLTGSQSGITRDSVSISWNWKNHP 252 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.316 0.132 0.374 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,849 Number of Sequences: 1233 Number of extensions: 1858 Number of successful extensions: 9 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 86 length of database: 328,796 effective HSP length: 55 effective length of query: 31 effective length of database: 260,981 effective search space: 8090411 effective search space used: 8090411 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.7 bits) S2: 31 (16.5 bits)