Query gi|254780888|ref|YP_003065301.1| hypothetical protein CLIBASIA_03925 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 64 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 30 00:06:31 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780888.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 KOG3809 consensus 31.4 16 0.00042 18.5 0.4 40 2-41 378-422 (583) 2 TIGR02312 HpaH 2-oxo-hepta-3-e 15.2 48 0.0012 16.1 0.2 35 3-39 182-216 (271) 3 COG1735 Php Predicted metal-de 10.2 71 0.0018 15.3 -0.2 21 7-30 69-89 (316) 4 TIGR02945 SUF_assoc FeS assemb 8.6 82 0.0021 15.0 -0.4 23 34-63 74-96 (96) 5 pfam03326 Herpes_TAF50 Herpesv 8.0 1.6E+02 0.0042 13.5 0.9 46 6-51 83-132 (500) 6 KOG3356 consensus 7.8 2E+02 0.005 13.1 1.2 17 27-43 44-60 (147) 7 pfam10034 Dpy19 Q-cell neurobl 7.7 1.4E+02 0.0034 13.9 0.4 23 29-51 60-82 (637) 8 KOG1015 consensus 5.6 2.4E+02 0.006 12.7 0.7 37 6-42 702-740 (1567) 9 TIGR00623 sula cell division i 5.4 2.9E+02 0.0074 12.2 1.0 27 11-37 12-38 (168) 10 TIGR01747 diampropi_NH3ly diam 5.2 1.7E+02 0.0044 13.4 -0.2 9 55-63 46-54 (378) No 1 >KOG3809 consensus Probab=31.38 E-value=16 Score=18.47 Aligned_cols=40 Identities=30% Similarity=0.253 Sum_probs=29.2 Q ss_pred CCCCCCHHHHHHHHHHHCCCCCCCCCCCCEE-----EEEECCCHH Q ss_conf 4121103320023222001463000003034-----543178415 Q gi|254780888|r 2 RIRPIHAMDMGRTVVKMSKSGVISEKTGLMS-----AVIIEPPHI 41 (64) Q Consensus 2 rirpihamdmgrtvvkmsksgvisektglms-----aviiepphi 41 (64) |-+-+.+.||.+.+++|++|.||+|..+... -|+++.+.. T Consensus 378 r~~~ie~v~~~~~~~~~~~snVi~e~~~~~~edd~nfV~e~d~~~ 422 (583) T KOG3809 378 RKKQIETVDSTPQVVVELKSNVISEAPKVETEDDSNFVMENDEED 422 (583) T ss_pred HHHHHHHHHCCCHHHHHHHHHHCCCCCCCCCCCCCCEEEECCCCC T ss_conf 332046662780366564202100377776666654156126000 No 2 >TIGR02312 HpaH 2-oxo-hepta-3-ene-1,7-dioic acid hydratase; InterPro: IPR012690 This entry represents the enzyme which hydrates the double bond of 2-oxo-hepta-3-ene-1,7-dioic acid to form 4-hydroxy-2-oxo-heptane-1,7-dioic acid in the catabolism of 4-hydroxyphenylacetic acid. The gene for this enzyme is generally found adjacent to other genes of this pathway.. Probab=15.24 E-value=48 Score=16.12 Aligned_cols=35 Identities=31% Similarity=0.636 Sum_probs=27.6 Q ss_pred CCCCCHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCC Q ss_conf 1211033200232220014630000030345431784 Q gi|254780888|r 3 IRPIHAMDMGRTVVKMSKSGVISEKTGLMSAVIIEPP 39 (64) Q Consensus 3 irpihamdmgrtvvkmsksgvisektglmsaviiepp 39 (64) +|| .+.|+-|.-.-+++.||| |.|||-..|.=.|- T Consensus 182 vrp-~~~DLRw~GA~L~~Ngvv-EETGlaAGVLNHPA 216 (271) T TIGR02312 182 VRP-DELDLRWVGAVLYRNGVV-EETGLAAGVLNHPA 216 (271) T ss_pred CCC-CCCCHHHHHHHHHCCCEE-EEHHHHHHHHCCCC T ss_conf 351-013516677876217725-65001345327873 No 3 >COG1735 Php Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Probab=10.23 E-value=71 Score=15.27 Aligned_cols=21 Identities=43% Similarity=0.743 Sum_probs=16.0 Q ss_pred CHHHHHHHHHHHCCCCCCCCCCCC Q ss_conf 033200232220014630000030 Q gi|254780888|r 7 HAMDMGRTVVKMSKSGVISEKTGL 30 (64) Q Consensus 7 hamdmgrtvvkmsksgvisektgl 30 (64) ..+++||.+.+|- .||+.||| T Consensus 69 T~~~~GRdv~~m~---~vs~atgl 89 (316) T COG1735 69 TNIGIGRDVLKMR---RVAEATGL 89 (316) T ss_pred CCCCCCCCHHHHH---HHHHHHCC T ss_conf 7645474889999---99997198 No 4 >TIGR02945 SUF_assoc FeS assembly SUF system protein; InterPro: IPR014291 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] . FeS cluster assembly is a complex process involving the mobilisation of Fe and S atoms from storage sources, their assembly into [Fe-S] form, their transport to specific cellular locations, and their transfer to recipient apoproteins. So far, three FeS assembly machineries have been identified, which are capable of synthesising all types of [Fe-S] clusters: ISC (iron-sulphur cluster), SUF (sulphur assimilation), and NIF (nitrogen fixation) systems. The ISC system is conserved in eubacteria and eukaryotes (mitochondria), and has broad specificity, targeting general FeS proteins , . It is encoded by the isc operon (iscRSUA-hscBA-fdx-iscX). IscS is a cysteine desulphurase, which obtains S from cysteine (converting it to alanine) and serves as a S donor for FeS cluster assembly. IscU and IscA act as scaffolds to accept S and Fe atoms, assembling clusters and transfering them to recipient apoproteins. HscA is a molecular chaperone and HscB is a co-chaperone. Fdx is a [2Fe-2S]-type ferredoxin. IscR is a transcription factor that regulates expression of the isc operon. IscX (also known as YfhJ) appears to interact with IscS and may function as an Fe donor during cluster assembly . The SUF system is an alternative pathway to the ISC system that operates under iron starvation and oxidative stress. It is found in eubacteria, archaea and eukaryotes (plastids). The SUF system is encoded by the suf operon (sufABCDSE), and the six encoded proteins are arranged into two complexes (SufSE and SufBCD) and one protein (SufA). SufS is a pyridoxal-phosphate (PLP) protein displaying cysteine desulphurase activity. SufE acts as a scaffold protein that accepts S from SufS and donates it to SufA . SufC is an ATPase with an unorthodox ATP-binding cassette (ABC)-like component. No specific functions have been assigned to SufB and SufD. SufA is homologous to IscA , acting as a scaffold protein in which Fe and S atoms are assembled into [FeS] cluster forms, which can then easily be transferred to apoproteins targets. In the NIF system, NifS and NifU are required for the formation of metalloclusters of nitrogenase in Azotobacter vinelandii, and other organisms, as well as in the maturation of other FeS proteins. Nitrogenase catalyses the fixation of nitrogen. It contains a complex cluster, the FeMo cofactor, which contains molybdenum, Fe and S. NifS is a cysteine desulphurase. NifU binds one Fe atom at its N-terminal, assembling an FeS cluster that is transferred to nitrogenase apoproteins . Nif proteins involved in the formation of FeS clusters can also be found in organisms that do not fix nitrogen . This entry is a subset of the larger DUF59 family. Many members of DUF59 are candidate ring hydroxylating complex subunits. However, members of the narrower family defined here are all found as part of the FeS assembly SUF system locus, in a subset of SUF-positive proteobacteria. . Probab=8.60 E-value=82 Score=14.97 Aligned_cols=23 Identities=35% Similarity=0.673 Sum_probs=14.7 Q ss_pred EEECCCHHHHHHHHHHHHHEECCCCCCEEC Q ss_conf 431784153397664235210001021321 Q gi|254780888|r 34 VIIEPPHIINIIKIMNIIMIKSARLGLNLF 63 (64) Q Consensus 34 viiepphiiniikimniimiksarlglnlf 63 (64) ..-+||---. -|-..|||-||+| T Consensus 74 lvwdPPW~~~-------RMSdeArL~Lg~~ 96 (96) T TIGR02945 74 LVWDPPWDMD-------RMSDEARLELGMF 96 (96) T ss_pred EEECCCCCCC-------CCCHHHHHHCCCC T ss_conf 6767866923-------3677899841579 No 5 >pfam03326 Herpes_TAF50 Herpesvirus transcription activation factor (transactivator). This family includes EBV BRLF1 and similar ORF 50 proteins from other herpesviruses. Probab=7.96 E-value=1.6e+02 Score=13.48 Aligned_cols=46 Identities=22% Similarity=0.421 Sum_probs=36.0 Q ss_pred CCHHHHHHHHHH----HCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHH Q ss_conf 103320023222----0014630000030345431784153397664235 Q gi|254780888|r 6 IHAMDMGRTVVK----MSKSGVISEKTGLMSAVIIEPPHIINIIKIMNII 51 (64) Q Consensus 6 ihamdmgrtvvk----msksgvisektglmsaviiepphiiniikimnii 51 (64) .+-|..|+.|+. +.+.|.||.+---.-....-|+.+-|+++.|+.. T Consensus 83 ~~~M~~gk~v~~~y~~l~~~G~is~~~kAf~kl~Fp~~~l~~vf~pm~~~ 132 (500) T pfam03326 83 RALMTLGKQVLTCYNTLRAEGLISPKVKAFIKLVFPPPDLENVFQPLFQS 132 (500) T ss_pred HHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHH T ss_conf 99999989999999875104676888998880107765789998899998 No 6 >KOG3356 consensus Probab=7.82 E-value=2e+02 Score=13.06 Aligned_cols=17 Identities=41% Similarity=0.749 Sum_probs=12.0 Q ss_pred CCCCEEEEEECCCHHHH Q ss_conf 00303454317841533 Q gi|254780888|r 27 KTGLMSAVIIEPPHIIN 43 (64) Q Consensus 27 ktglmsaviiepphiin 43 (64) ..|..-.||.|||.|-. T Consensus 44 ~~g~iydvivepp~igs 60 (147) T KOG3356 44 TGGIIYDVIVEPPSIGS 60 (147) T ss_pred CCCEEEEEEECCCCCCC T ss_conf 25578999865998785 No 7 >pfam10034 Dpy19 Q-cell neuroblast polarisation. Dyp-19, formerly known as DUF2211, is a transmembrane domain family that is required to orient the neuroblast cells, QR and QL accurately on the anterior-posterior axis: QL and QR are born in the same anterior-posterior position, but polarize and migrate left-right asymmetrically, QL migrating towards the posterior and QR migrating towards the anterior. It is also required, with unc-40, to express mab-5 correctly in the Q cell descendants. The Dpy-19 protein derives from the C. elegans DUMPY mutant. Probab=7.73 E-value=1.4e+02 Score=13.89 Aligned_cols=23 Identities=30% Similarity=0.313 Sum_probs=18.2 Q ss_pred CCEEEEEECCCHHHHHHHHHHHH Q ss_conf 30345431784153397664235 Q gi|254780888|r 29 GLMSAVIIEPPHIINIIKIMNII 51 (64) Q Consensus 29 glmsaviiepphiiniikimnii 51 (64) .+|..-..|-|+.||.++-+|+- T Consensus 60 ~l~~Dn~TEyp~~IN~l~RFnlY 82 (637) T pfam10034 60 LLMNDNRTEYPLTINTLQRFNLY 82 (637) T ss_pred HHHCCCCCCCCHHHHHHHHCCCC T ss_conf 99638875372467788870534 No 8 >KOG1015 consensus Probab=5.65 E-value=2.4e+02 Score=12.69 Aligned_cols=37 Identities=27% Similarity=0.545 Sum_probs=29.0 Q ss_pred CCHHHHHHH--HHHHCCCCCCCCCCCCEEEEEECCCHHH Q ss_conf 103320023--2220014630000030345431784153 Q gi|254780888|r 6 IHAMDMGRT--VVKMSKSGVISEKTGLMSAVIIEPPHII 42 (64) Q Consensus 6 ihamdmgrt--vvkmsksgvisektglmsaviiepphii 42 (64) -|.|..|.| ||.....-...+++|+-.|.|+-|-..+ T Consensus 702 AHcMGLGKTlQVvtflhTvL~c~klg~ktaLvV~PlNt~ 740 (1567) T KOG1015 702 AHCMGLGKTLQVVTFLHTVLLCDKLGFKTALVVCPLNTA 740 (1567) T ss_pred HHHHCCCCEEHHHHHHHHHHHHHCCCCCEEEEECCHHHH T ss_conf 875045640014678889987420478568997235998 No 9 >TIGR00623 sula cell division inhibitor SulA; InterPro: IPR004596 All proteins in this family for which the functions are known are cell division inhibitors. In Escherichia coli, SulA is one of the SOS regulated genes. Accumulation of SulA causes rapid cessation of cell division and the appearance of long, non-septate filaments. The expression of SulA is repressed by LexA. The N-terminus of SulA may be involved in recognising the cell division apparatus.; GO: 0009432 SOS response, 0009276 1-2nm peptidoglycan-based cell wall. Probab=5.40 E-value=2.9e+02 Score=12.23 Aligned_cols=27 Identities=19% Similarity=0.359 Sum_probs=21.2 Q ss_pred HHHHHHHHCCCCCCCCCCCCEEEEEEC Q ss_conf 002322200146300000303454317 Q gi|254780888|r 11 MGRTVVKMSKSGVISEKTGLMSAVIIE 37 (64) Q Consensus 11 mgrtvvkmsksgvisektglmsaviie 37 (64) ...|+-+.+++..+...+||.|.|+.. T Consensus 12 ~s~~~~~~a~~~~~~~~~GLiSE~VY~ 38 (168) T TIGR00623 12 FSATTRNVARNTTENKAAGLISEVVYR 38 (168) T ss_pred CHHHHHHHHHHHHHHCCCCCEEEEEEC T ss_conf 405666555532100004715666542 No 10 >TIGR01747 diampropi_NH3ly diaminopropionate ammonia-lyase; InterPro: IPR010081 This small family includes diaminopropionate ammonia-lyase from Salmonella typhimurium and a small number of close homologs, about 50 0dentical in sequence. The enzyme is a pyridoxal phosphate-binding homodimer homologous to threonine dehydratase (threonine deaminase).. Probab=5.19 E-value=1.7e+02 Score=13.36 Aligned_cols=9 Identities=67% Similarity=0.995 Sum_probs=0.0 Q ss_pred CCCCCCEEC Q ss_conf 001021321 Q gi|254780888|r 55 SARLGLNLF 63 (64) Q Consensus 55 sarlglnlf 63 (64) |-|.|||-| T Consensus 46 S~RFGLNAF 54 (378) T TIGR01747 46 SYRFGLNAF 54 (378) T ss_pred CCHHCHHHH T ss_conf 421011466 Done!