>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera

Probab=99.84 E-value=1.4e-20 Score=166.96 Aligned_cols=106 Identities=32% Similarity=0.488 Sum_probs=95.0 Q ss_pred CCCEEEECCCCHHHHHHHHHHHCCCCEEEECCCCEEEEEEEEHHHHCCC----------------------------CCC Q ss_conf 2878994654303456566760504167866886027887235450014----------------------------344 Q gi|254780889|r 100 VNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFA----------------------------SNA 151 (493) Q Consensus 100 ~dPVti~pd~TI~ea~~lm~~~~is~iPVVD~~~gkLiGIVT~rDir~~----------------------------~~~ 151 (493) T Consensus 1 kdVitv~p~~tl~ea~~~m~~~~i~~lpVvd~~-g~lvGivT~~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 79 (135) T cd04621 1 EDIATVHPEHSLLHVVDEMEKNGVGRVIVVDDN-GKPVGVITYRDLAFAEFEDNERGLPKKSIKMKRKAGQKRYRYVKEV 79 (135) T ss_pred CCCEEECCCCCHHHHHHHHHHCCCCEEEEECCC-CEEEEEEEHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHCCCC T ss_conf 986898994979999999987499779999599-9399999879988666314544310233333101002332101446 Q ss_pred CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCEEEEEEECCCHH Q ss_conf 67244002678632573035899999998655330645747997868898021000 Q gi|254780889|r 152 QQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIER 207 (493) Q Consensus 152 ~~~V~eiMt~~litv~~~~~l~eA~~iM~~~ki~~LPVVDe~g~LvGIIT~~DIlk 207 (493) T Consensus 80 ~~~v~diMt~~vitv~~d~~l~~a~~~M~~~~i~~lPVvd-~~~lvGiIt~~Dilr 134 (135) T cd04621 80 PLVAEDIMTEEIITVSPNDDVVDAAKLMLEANISGLPVVD-NDNIVGVITKTDICR 134 (135) T ss_pred CCCHHHHCCCCCEEECCCCCHHHHHHHHHHCCCCEEEEEE-CCEEEEEEEHHHHCC T ss_conf 8899893889988998989399999999971998899998-999999998588116

HHsearch alignment for GI: 254780889 and conserved domain: cd04621