RPSBLAST alignment for GI: 254780889 and conserved domain: cd04586
>gnl|CDD|73086 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain. BON is a putative phospholipid-binding domain found in a family of osmotic shock protection proteins. It is also found in some secretins and a group of potential haemolysins. Its likely function is attachment to phospholipid membranes. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 135
Score = 42.0 bits (99), Expect = 4e-04
Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%)
Query: 98 MVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDV 145
M VT+ LA+ LM+++ I +PVV G+LVGI++ D+
Sbjct: 87 MTRPVVTVGEDTPLAEVAELMEEHRIKRVPVVRG--GRLVGIVSRADL 132