RPSBLAST alignment for GI: 254780889 and conserved domain: cd04597

>gnl|CDD|73097 cd04597, CBS_pair_DRTGG_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream. The function of the DRTGG domain, named after its conserved residues, is unknown. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 113
 Score = 45.3 bits (107), Expect = 4e-05
 Identities = 20/63 (31%), Positives = 32/63 (50%)

Query: 146 RFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDI 205
              ++    V +++ R  +T +    L  A  L+H+H I  L VVDDDG   G+IT+ D+
Sbjct: 51  ILLADVHPRVRDVINRKPVTARPNDPLREALNLMHEHNIRTLPVVDDDGTPAGIITLLDL 110

Query: 206 ERS 208
              
Sbjct: 111 AEK 113