RPSBLAST alignment for GI: 254780889 and conserved domain: cd04605

>gnl|CDD|73105 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain. Met2 is a key enzyme in the biosynthesis of methionine. It encodes a homoserine transacetylase involved in converting homoserine to O-acetyl homoserine. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 110
 Score = 38.7 bits (90), Expect = 0.004
 Identities = 20/64 (31%), Positives = 39/64 (60%), Gaps = 3/64 (4%)

Query: 82  SEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILT 141
           S+ VA+    K  E  M  N +T +P   +  A   M++++IS +PVV+++  +++GI+T
Sbjct: 47  SKAVAR--DKKSVEDIMTRNVITATPDEPIDVAARKMERHNISALPVVDAE-NRVIGIIT 103

Query: 142 NRDV 145
           + D+
Sbjct: 104 SEDI 107