>gnl|CDD|73121 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 113

 Score = 39.3 bits (92), Expect = 0.003
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 98  MVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDV 145
           M    VT++    + +A  LM+++ +  +PVV+ D G+LVGI++  D+
Sbjct: 64  MTRGVVTVTEDDDVDEAARLMREHQVRRLPVVDDD-GRLVGIVSLGDL 110