RPSBLAST alignment for GI: 254780889 and conserved domain: cd04634

>gnl|CDD|73132 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 143
 Score = 41.8 bits (98), Expect = 4e-04
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 91  VKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDV 145
             K    M    +TISP A++ DA  LM ++ I  +PVVE   G+LVGI+T  D+
Sbjct: 88  KMKVRDIMTKKVITISPDASIEDAAELMVRHKIKRLPVVED--GRLVGIVTRGDI 140