>gnl|CDD|73135 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 122

 Score = 52.2 bits (125), Expect = 3e-07
 Identities = 21/59 (35%), Positives = 38/59 (64%), Gaps = 7/59 (11%)

Query: 87  QVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDV 145
           + HQ+      M  +P+T+SP   + +A  L+ + SIS +PVV+ + G+L+GI+T +D+
Sbjct: 68  RAHQI------MTRDPITVSPDTPVDEASKLLLENSISCLPVVDEN-GQLIGIITWKDL 119