BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780890|ref|YP_003065303.1| hypothetical protein
CLIBASIA_03935 [Candidatus Liberibacter asiaticus str. psy62]
         (104 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780890|ref|YP_003065303.1| hypothetical protein CLIBASIA_03935 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040567|gb|ACT57363.1| hypothetical protein CLIBASIA_03935 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 104

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 104/104 (100%), Positives = 104/104 (100%)

Query: 1   MFYDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYIITARIIALIVF 60
           MFYDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYIITARIIALIVF
Sbjct: 1   MFYDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYIITARIIALIVF 60

Query: 61  REGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQHQCKSIERDS 104
           REGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQHQCKSIERDS
Sbjct: 61  REGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQHQCKSIERDS 104


>gi|315122693|ref|YP_004063182.1| hypothetical protein CKC_04725 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496095|gb|ADR52694.1| hypothetical protein CKC_04725 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 100

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 49/98 (50%), Positives = 73/98 (74%)

Query: 5   SREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYIITARIIALIVFREGE 64
           S  K   LES+V+++IRLQIEEI  IL+++ ++  ++E+ TK+Y++TARIIAL   REG+
Sbjct: 3   STRKNDCLESKVIYSIRLQIEEIFKILTQEKKEISDKELYTKMYLVTARIIALTALREGK 62

Query: 65  KSLIFDLLRTNQKTNSSLTQAIIQEIDTLQHQCKSIER 102
           KS IF  L+ N+K +S LTQ  +QEIDTL++Q   I++
Sbjct: 63  KSPIFHYLKKNKKYDSLLTQTTMQEIDTLKYQLTPIKK 100


>gi|332667493|ref|YP_004450281.1| signal transduction histidine kinase [Haliscomenobacter hydrossis
           DSM 1100]
 gi|332336307|gb|AEE53408.1| signal transduction histidine kinase [Haliscomenobacter hydrossis
           DSM 1100]
          Length = 609

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 50/94 (53%), Gaps = 4/94 (4%)

Query: 5   SREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYIITARIIALI----VF 60
           S E+++ L+ E+ H ++  ++ I ++L  +  D  ++  R  +  +++RI A+     V 
Sbjct: 401 SLEQQIMLQGEIHHRVKNNLQVIISLLELQKEDIKDENTRNGLEAMSSRIYAIAAVHDVL 460

Query: 61  REGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQ 94
            +G++  + D L   +K  S L QA+ +E  T Q
Sbjct: 461 YQGQEGQLVDFLNYTKKLCSHLQQAMAREDSTFQ 494


>gi|149186824|ref|ZP_01865134.1| putative signal transduction histidine kinase with GAF domain
          [Erythrobacter sp. SD-21]
 gi|148829491|gb|EDL47932.1| putative signal transduction histidine kinase with GAF domain
          [Erythrobacter sp. SD-21]
          Length = 208

 Score = 40.1 bits (92), Expect = 0.092,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 46/89 (51%), Gaps = 4/89 (4%)

Query: 7  EKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYIITARIIALIVFREGEKS 66
          E+E  L  EV H ++  +  IS+I++ K+R +P++  RT +  I  RI +L    E  + 
Sbjct: 11 EREQTLRREVDHRVKNSLASISSIITMKARRSPDEGTRTALEDIGLRIRSLASLHEQLQD 70

Query: 67 L----IFDLLRTNQKTNSSLTQAIIQEID 91
          +      DL+   ++  + L Q + Q +D
Sbjct: 71 VGAHQTVDLVVLFERVGTDLRQLLPQGVD 99


>gi|306841654|ref|ZP_07474343.1| Peptidoglycan-binding domain 1 protein [Brucella sp. BO2]
 gi|306288267|gb|EFM59647.1| Peptidoglycan-binding domain 1 protein [Brucella sp. BO2]
          Length = 946

 Score = 40.1 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 3   YDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYII-----TARIIAL 57
           Y SR      +SE +HN+  QI  I+  L++ SR+    EIR ++  I     + R I L
Sbjct: 261 YASRYGPSSADSEAIHNLEQQIASIAQHLAQPSREL--SEIRPRLDSIERSLHSNREIVL 318

Query: 58  IVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQ 94
              RE  +S++  +L+   K+ +++ Q +  ++  L+
Sbjct: 319 DAAREATESVVARMLQHGPKSETAIAQQLAADMKALE 355


>gi|294853408|ref|ZP_06794080.1| peptidoglycan-binding protein [Brucella sp. NVSL 07-0026]
 gi|294819063|gb|EFG36063.1| peptidoglycan-binding protein [Brucella sp. NVSL 07-0026]
          Length = 978

 Score = 40.1 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 3   YDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYII-----TARIIAL 57
           Y SR      +SE +HN+  QI  I+  L++ SR+    EIR ++  I     + R I L
Sbjct: 293 YASRYGASSADSEAIHNLEQQIASIAQHLAQPSREL--AEIRPRLDSIERSLHSNREIVL 350

Query: 58  IVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQ 94
              RE  +S++  +L+   K+ +++ Q +  ++  L+
Sbjct: 351 DAAREATESVVARMLQHGPKSETAIAQQLAADMKALE 387


>gi|265999048|ref|ZP_06111541.1| peptidoglycan binding domain-containing protein [Brucella
           melitensis bv. 2 str. 63/9]
 gi|263092001|gb|EEZ16298.1| peptidoglycan binding domain-containing protein [Brucella
           melitensis bv. 2 str. 63/9]
 gi|326410976|gb|ADZ68040.1| peptidoglycan-binding domain 1 protein [Brucella melitensis M28]
 gi|326554267|gb|ADZ88906.1| peptidoglycan-binding domain 1 protein [Brucella melitensis M5-90]
          Length = 978

 Score = 40.1 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 3   YDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYII-----TARIIAL 57
           Y SR      +SE +HN+  QI  I+  L++ SR+    EIR ++  I     + R I L
Sbjct: 293 YASRYGASSADSEAIHNLEQQIASIAQHLAQPSREL--AEIRPRLDSIERSLHSNREIVL 350

Query: 58  IVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQ 94
              RE  +S++  +L+   K+ +++ Q +  ++  L+
Sbjct: 351 DAAREATESVVARMLQHGPKSETAIAQQLAADMKALE 387


>gi|265992772|ref|ZP_06105329.1| peptidoglycan binding domain-containing protein [Brucella
           melitensis bv. 3 str. Ether]
 gi|262763642|gb|EEZ09674.1| peptidoglycan binding domain-containing protein [Brucella
           melitensis bv. 3 str. Ether]
          Length = 978

 Score = 40.1 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 3   YDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYII-----TARIIAL 57
           Y SR      +SE +HN+  QI  I+  L++ SR+    EIR ++  I     + R I L
Sbjct: 293 YASRYGASSADSEAIHNLEQQIASIAQHLAQPSREL--AEIRPRLDSIERSLHSNREIVL 350

Query: 58  IVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQ 94
              RE  +S++  +L+   K+ +++ Q +  ++  L+
Sbjct: 351 DAAREATESVVARMLQHGPKSETAIAQQLAADMKALE 387


>gi|261750518|ref|ZP_05994227.1| peptidoglycan-binding domain 1 protein [Brucella suis bv. 5 str.
           513]
 gi|261740271|gb|EEY28197.1| peptidoglycan-binding domain 1 protein [Brucella suis bv. 5 str.
           513]
          Length = 942

 Score = 40.1 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 3   YDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYII-----TARIIAL 57
           Y SR      +SE +HN+  QI  I+  L++ SR+    EIR ++  I     + R I L
Sbjct: 293 YASRYGASSADSEAIHNLEQQIASIAQHLAQPSREL--AEIRPRLDSIERSLHSNREIVL 350

Query: 58  IVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQ 94
              RE  +S++  +L+   K+ +++ Q +  ++  L+
Sbjct: 351 DAAREATESVVARMLQHGPKSETAIAQQLAADMKALE 387


>gi|261322945|ref|ZP_05962142.1| peptidoglycan binding domain-containing protein [Brucella neotomae
           5K33]
 gi|261298925|gb|EEY02422.1| peptidoglycan binding domain-containing protein [Brucella neotomae
           5K33]
          Length = 959

 Score = 40.1 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 3   YDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYII-----TARIIAL 57
           Y SR      +SE +HN+  QI  I+  L++ SR+    EIR ++  I     + R I L
Sbjct: 293 YASRYGASSADSEAIHNLEQQIASIAQHLAQPSREL--AEIRPRLDSIERSLHSNREIVL 350

Query: 58  IVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQ 94
              RE  +S++  +L+   K+ +++ Q +  ++  L+
Sbjct: 351 DAAREATESVVARMLQHGPKSETAIAQQLAADMKALE 387


>gi|261217417|ref|ZP_05931698.1| peptidoglycan-binding domain 1 protein [Brucella ceti M13/05/1]
 gi|261320291|ref|ZP_05959488.1| peptidoglycan-binding domain 1 protein [Brucella ceti M644/93/1]
 gi|260922506|gb|EEX89074.1| peptidoglycan-binding domain 1 protein [Brucella ceti M13/05/1]
 gi|261292981|gb|EEX96477.1| peptidoglycan-binding domain 1 protein [Brucella ceti M644/93/1]
          Length = 978

 Score = 40.1 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 3   YDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYII-----TARIIAL 57
           Y SR      +SE +HN+  QI  I+  L++ SR+    EIR ++  I     + R I L
Sbjct: 293 YASRYGASSADSEAIHNLEQQIASIAQHLAQPSREL--AEIRPRLDSIERSLHSNREIVL 350

Query: 58  IVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQ 94
              RE  +S++  +L+   K+ +++ Q +  ++  L+
Sbjct: 351 DAAREATESVVARMLQHGPKSETAIAQQLAADMKALE 387


>gi|261216267|ref|ZP_05930548.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|260917874|gb|EEX84735.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 3 str.
           Tulya]
          Length = 942

 Score = 40.1 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 3   YDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYII-----TARIIAL 57
           Y SR      +SE +HN+  QI  I+  L++ SR+    EIR ++  I     + R I L
Sbjct: 293 YASRYGASSADSEAIHNLEQQIASIAQHLAQPSREL--AEIRPRLDSIERSLHSNREIVL 350

Query: 58  IVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQ 94
              RE  +S++  +L+   K+ +++ Q +  ++  L+
Sbjct: 351 DAAREATESVVARMLQHGPKSETAIAQQLAADMKALE 387


>gi|260756423|ref|ZP_05868771.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 6 str.
           870]
 gi|260676531|gb|EEX63352.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 6 str.
           870]
          Length = 893

 Score = 40.1 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 3   YDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYII-----TARIIAL 57
           Y SR      +SE +HN+  QI  I+  L++ SR+    EIR ++  I     + R I L
Sbjct: 293 YASRYGASSADSEAIHNLEQQIASIAQHLAQPSREL--AEIRPRLDSIERSLHSNREIVL 350

Query: 58  IVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQ 94
              RE  +S++  +L+   K+ +++ Q +  ++