RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780890|ref|YP_003065303.1| hypothetical protein CLIBASIA_03935 [Candidatus Liberibacter asiaticus str. psy62] (104 letters) >gnl|CDD|182849 PRK10933, PRK10933, trehalose-6-phosphate hydrolase; Provisional. Length = 551 Score = 27.4 bits (61), Expect = 0.95 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 3/20 (15%) Query: 25 EEISAILSKKSRD---TPNQ 41 +E+ AIL+ KSRD TP Q Sbjct: 399 DELLAILASKSRDNSRTPMQ 418 >gnl|CDD|181807 PRK09374, rplB, 50S ribosomal protein L2; Validated. Length = 276 Score = 25.4 bits (57), Expect = 2.9 Identities = 9/18 (50%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Query: 51 TARIIALIVFREGEKSLI 68 +ARI AL+ + +GEK I Sbjct: 88 SARI-ALLHYADGEKRYI 104 >gnl|CDD|161981 TIGR00656, asp_kin_monofn, aspartate kinase, monofunctional class. The Lys-sensitive enzyme of Bacillus subtilis resembles the E. coli form but is an alpha 2/beta 2 heterotetramer, where the beta subunit is translated from an in-phase alternative initiator at Met-246. The protein slr0657 from Synechocystis PCC6803 is extended by a duplication of the C-terminal region corresponding to the beta chain. Incorporation of a second copy of the C-terminal domain may be quite common in this subgroup of aspartokinases. Length = 401 Score = 25.4 bits (56), Expect = 3.3 Identities = 12/68 (17%), Positives = 28/68 (41%), Gaps = 4/68 (5%) Query: 25 EEISAILSKKSRDTPNQEIRTKIYIITARIIALIVFREGEKSLIFDLLRTNQKTNSSLTQ 84 + I ++ + RD E+ + +++ + + + G K++ D T+ + Sbjct: 55 KAIRDAITPRERD----ELVSHGERLSSALFSGALRDLGVKAIWLDGGEAGIITDDNFGN 110 Query: 85 AIIQEIDT 92 A I I T Sbjct: 111 AKIDIIAT 118 >gnl|CDD|150842 pfam10231, DUF2315, Uncharacterized conserved protein (DUF2315). This is a family of small conserved proteins found from worms to humans. The function is not known. Length = 127 Score = 24.8 bits (54), Expect = 5.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 5 SREKEVFLESEVVHNIRLQIEEISA 29 S+EKE F+ E + + EE+SA Sbjct: 55 SKEKEAFIRKEQLRKESGRTEEVSA 79 >gnl|CDD|162843 TIGR02403, trehalose_treC, alpha,alpha-phosphotrehalase. Trehalose is a glucose disaccharide that serves in many biological systems as a compatible solute for protection against hyperosmotic and thermal stress. This family describes trehalose-6-phosphate hydrolase, product of the treC (or treA) gene, which is often found together with a trehalose uptake transporter and a trehalose operon repressor. Length = 543 Score = 24.6 bits (54), Expect = 6.5 Identities = 12/20 (60%), Positives = 13/20 (65%), Gaps = 3/20 (15%) Query: 25 EEISAILSKKSRD---TPNQ 41 EE AIL +KSRD TP Q Sbjct: 393 EEALAILKQKSRDNSRTPMQ 412 >gnl|CDD|180382 PRK06069, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed. Length = 577 Score = 24.2 bits (53), Expect = 7.2 Identities = 11/40 (27%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Query: 25 EEISAILSKKSRDTPNQEIRTKIYIITARIIALIVFREGE 64 + I L KK P+ EIR ++ I + +FR+ Sbjct: 433 KRIFDKLLKKEGGEPSYEIRRELNDIMDK--NFGIFRDES 470 >gnl|CDD|162706 TIGR02104, pulA_typeI, pullulanase, type I. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the subfamilies described in TIGR02102 and TIGR02103 but having a different domain architecture with shorter sequences. Members are called type I pullulanases. Length = 605 Score = 24.2 bits (53), Expect = 7.8 Identities = 11/36 (30%), Positives = 16/36 (44%), Gaps = 8/36 (22%) Query: 63 GEKSLIFDLLRTN-----QKTNSSL---TQAIIQEI 90 G++ + DL RTN + L AII E+ Sbjct: 98 GKRGAVIDLERTNPEGWEKDHRPRLENPEDAIIYEL 133 >gnl|CDD|178730 PLN03188, PLN03188, kinesin-12 family protein; Provisional. Length = 1320 Score = 24.1 bits (52), Expect = 7.9 Identities = 10/24 (41%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Query: 2 FYDSREKEVFLESEVVHNIRLQIE 25 FYD E+EV LE + ++R Q++ Sbjct: 982 FYDMGEREVLLEE--IQDLRSQLQ 1003 >gnl|CDD|179102 PRK00733, hppA, membrane-bound proton-translocating pyrophosphatase; Validated. Length = 666 Score = 23.9 bits (53), Expect = 8.6 Identities = 6/22 (27%), Positives = 11/22 (50%) Query: 15 EVVHNIRLQIEEISAILSKKSR 36 +V +R Q EI I+ ++ Sbjct: 514 AMVEEVRRQFREIPGIMEGTAK 535 >gnl|CDD|162131 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein. Length = 1394 Score = 23.9 bits (52), Expect = 9.0 Identities = 8/30 (26%), Positives = 15/30 (50%) Query: 9 EVFLESEVVHNIRLQIEEISAILSKKSRDT 38 EV+ S ++ +++ + A LSK D Sbjct: 1035 EVWRNSSEYQAVKNELDRLEAELSKAEDDN 1064 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.133 0.345 Gapped Lambda K H 0.267 0.0713 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,544,348 Number of extensions: 84777 Number of successful extensions: 175 Number of sequences better than 10.0: 1 Number of HSP's gapped: 175 Number of HSP's successfully gapped: 33 Length of query: 104 Length of database: 5,994,473 Length adjustment: 71 Effective length of query: 33 Effective length of database: 4,460,305 Effective search space: 147190065 Effective search space used: 147190065 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.1 bits)