RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780890|ref|YP_003065303.1| hypothetical protein CLIBASIA_03935 [Candidatus Liberibacter asiaticus str. psy62] (104 letters) >3hhc_A Interleukin-28B; interferon, IL-22, antiviral, antiviral defense, cytokine, secreted; 2.80A {Homo sapiens} (A:) Length = 196 Score = 28.3 bits (63), Expect = 0.35 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Query: 53 RIIALIVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQH 95 R +AL E E +L +L T+ +L + Q + TL H Sbjct: 90 RPVAL----EAELALTLKVLEATADTDPALGDVLDQPLHTLHH 128 >2dyo_A Autophagy protein 5; ubiquitin-fold, herix-bundle, protein turnover/protein turnover complex; 1.97A {Saccharomyces cerevisiae} PDB: 2dym_A (A:1-13,A:135-297) Length = 176 Score = 25.2 bits (55), Expect = 3.1 Identities = 11/69 (15%), Positives = 19/69 (27%), Gaps = 8/69 (11%) Query: 31 LSKKSRDTPNQEIRTKIYIITARIIALIVFR----EGEKSLIFDLLRT----NQKTNSSL 82 +S K + + I I I G + D+ + N + Sbjct: 70 ISNKISSSRPRHIPLIIQTSRTSGTFRISQPTISMTGVNPTLKDIEGDILDVKEGINGND 129 Query: 83 TQAIIQEID 91 I Q I+ Sbjct: 130 VMVICQGIE 138 >2odr_A Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} (A:550-614) Length = 65 Score = 23.9 bits (51), Expect = 7.3 Identities = 3/7 (42%), Positives = 6/7 (85%) Query: 19 NIRLQIE 25 N+ ++IE Sbjct: 1 NVEVKIE 7 >2odr_B Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} (B:550-611) Length = 62 Score = 23.6 bits (50), Expect = 9.0 Identities = 3/7 (42%), Positives = 6/7 (85%) Query: 19 NIRLQIE 25 N+ ++IE Sbjct: 1 NVEVKIE 7 >1giy_D 50S ribosomal protein L2; ribosome assembly, protein synthesis, LIFE; 5.50A {Thermus thermophilus} (D:1-56) Length = 56 Score = 23.8 bits (52), Expect = 9.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Query: 55 IALIVFREGEKSLI 68 IALI + +GEK I Sbjct: 31 IALINYADGEKRYI 44 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.319 0.133 0.345 Gapped Lambda K H 0.267 0.0621 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 671,280 Number of extensions: 24395 Number of successful extensions: 66 Number of sequences better than 10.0: 1 Number of HSP's gapped: 66 Number of HSP's successfully gapped: 6 Length of query: 104 Length of database: 4,956,049 Length adjustment: 61 Effective length of query: 43 Effective length of database: 2,893,944 Effective search space: 124439592 Effective search space used: 124439592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.3 bits)