BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780890|ref|YP_003065303.1| hypothetical protein
CLIBASIA_03935 [Candidatus Liberibacter asiaticus str. psy62]
         (104 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780890|ref|YP_003065303.1| hypothetical protein CLIBASIA_03935 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 104

 Score =  206 bits (525), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%)

Query: 1   MFYDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYIITARIIALIVF 60
           MFYDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYIITARIIALIVF
Sbjct: 1   MFYDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYIITARIIALIVF 60

Query: 61  REGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQHQCKSIERDS 104
           REGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQHQCKSIERDS
Sbjct: 61  REGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQHQCKSIERDS 104


>gi|254780333|ref|YP_003064746.1| alanine racemase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 370

 Score = 23.9 bits (50), Expect = 0.71,   Method: Composition-based stats.
 Identities = 9/28 (32%), Positives = 16/28 (57%)

Query: 43 IRTKIYIITARIIALIVFREGEKSLIFD 70
          ++ ++Y   ARI  L     G++ +IFD
Sbjct: 69 VKLRLYTPQARIFVLYGIHPGQEKIIFD 96


>gi|254780925|ref|YP_003065338.1| bifunctional preprotein translocase subunit SecD/SecF [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 833

 Score = 20.8 bits (42), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 8/27 (29%), Positives = 16/27 (59%)

Query: 51  TARIIALIVFREGEKSLIFDLLRTNQK 77
            A ++ LI +   +K +++D +R N K
Sbjct: 723 VAAVLTLIGYSVNDKVVVYDRMRKNMK 749


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.319    0.133    0.345 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 55,536
Number of Sequences: 1233
Number of extensions: 1796
Number of successful extensions: 7
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of query: 104
length of database: 328,796
effective HSP length: 62
effective length of query: 42
effective length of database: 252,350
effective search space: 10598700
effective search space used: 10598700
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)
S2: 32 (16.9 bits)