HHsearch alignment for GI: 254780891 and conserved domain: PRK09835

>PRK09835 sensor kinase CusS; Provisional.
Probab=100.00  E-value=6.3e-37  Score=254.44  Aligned_cols=197  Identities=16%  Similarity=0.144  Sum_probs=139.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCHHHHHH---H----HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHH-
Q ss_conf             9997745454227999999999996144-30147898---8----8999999998631100112232000000000134-
Q gi|254780891|r   17 LLCSRICHDIISPIGAIHNSLELLDEVG-IEDEVMQL---I----RLSSMSAIIRLKFMRLAFGYTGSVDSLIGLGDIE-   87 (215)
Q Consensus        17 llas~IaHdlrtPL~~I~~~~elL~~~~-~~~~~~~~---i----~~~~~~~~~l~~~~r~~~~~~~~~~~~~~~~~~~-   87 (215)
T Consensus       264 ~f~a~vSHELRTPLt~i~~~~e~~l~~~~~~~~~~~~l~~~~~e~~rl~~lv~~lL~lar~e~~~~~~~~~~~dl~~~~~  343 (482)
T PRK09835        264 NFSADIAHEIRTPITNLITQTEIALSQSRSQKELEDVLYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLADEVG  343 (482)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHH
T ss_conf             99999889871899999999999853899869999999999999999999999999987743588766673456999999


Q ss_pred             HHHHHHH--HCCCCCCCCCCCC---CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCCHH
Q ss_conf             4444322--0122332110000---0010001234445676646876532001111123557720479998789844024
Q gi|254780891|r   88 QVIEDFI--AVDKRVQVSWTGE---KIDLSRERAKILLNLFMVAHASLPRGGKVTISVQDSKNENIFSLKINGNLARFPE  162 (215)
Q Consensus        88 ~~~~~~~--~~~~~~~~~~~~~---~~~~~~~~~qvl~NLi~NA~~a~~~gg~I~i~~~~~~~~~~i~V~D~G~Gi~~~e  162 (215)
T Consensus       344 ~~~~~~~~~~~~~~i~~~~~~~~~~v~~d~~~l~~~l~NLl~NAikys~~g~~i~i~~~~~~~~v~i~V~D~G~GI~-~e  422 (482)
T PRK09835        344 KVFDFFEALAEDRGVELRFVGDPCQVAGDPLMLRRALSNLLSNALRYTPEGEAIVVRCQTVDHQVQVVVENPGTPIA-PE  422 (482)
T ss_pred             HHHHHHHHHHHHCCCEEEEECCCEEEEECHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCEEEEEEEECCCCCC-HH
T ss_conf             99999999998689289982787089987999999999999999984899986999999829989999996587889-89


Q ss_pred             HHHHHHCCCCCC------CCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCEEEEEEEEC
Q ss_conf             588740545457------89987204999999999709879999877992699999419
Q gi|254780891|r  163 KFTQIVDGNVES------TIDSHDIQFYYVILLAHENKIRLLPEIIDDHNVVLSALLEK  215 (215)
Q Consensus       163 ~~~~~~~~~~~~------~~~g~GlGl~~~~~i~~~~gG~i~v~~~~~~g~~f~~~l~~  215 (215)
T Consensus       423 ~~~~iFerFyR~d~sr~~~~~G~GLGLaIvk~Iv~~hgG~i~v~s~-~~Gt~f~i~lPr  480 (482)
T PRK09835        423 HLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVAHKGTVAVTSD-ARGTRFVISLPR  480 (482)
T ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEC-CCCEEEEEEEEC
T ss_conf             9987667975189888899994648999999999982998999963-991899999307