RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780891|ref|YP_003065304.1| hypothetical protein CLIBASIA_03940 [Candidatus Liberibacter asiaticus str. psy62] (215 letters) >gnl|CDD|34947 COG5385, COG5385, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 214 Score = 187 bits (476), Expect = 2e-48 Identities = 87/212 (41%), Positives = 137/212 (64%), Gaps = 3/212 (1%) Query: 1 MAKNICFNLSSMDLVALLCSRICHDIISPIGAIHNSLELLDEVGIEDEVMQLIRLSSMSA 60 M + LS DL ALLCSR+CHDIISP+GAI+N LELLDE G +D+ M LIR S+ +A Sbjct: 1 MPASPNATLSGPDLAALLCSRVCHDIISPVGAINNGLELLDEGGADDDAMDLIRSSARNA 60 Query: 61 IIRLKFMRLAFGYTGSVDSLIGLGDIEQVIEDFIAVDKRVQVSWTGEKIDLSRERAKILL 120 +RL+F RLAFG +GS + I G+ E+ +DF A +++ +++W G + L + R K+LL Sbjct: 61 SVRLQFARLAFGASGSAGASIDTGEAEKAAQDFFA-NEKPELTWNGPRAILPKNRVKLLL 119 Query: 121 NLFMVAHASLPRGGKVTISVQDSKNENIFSLKINGNLARFPEKFTQIVDGN-VESTIDSH 179 NLF++A+ ++PRGG + +++++ + + FS+ G + R P KF ++ G E +D+H Sbjct: 120 NLFLIAYGAIPRGGSLVVTLENPETDARFSIIAKGRMMRVPPKFLELHSGEPPEEAVDAH 179 Query: 180 DIQFYYVILLAHENKIRLLPEIIDDHNVVLSA 211 +Q YY +LLA E + + + +V +A Sbjct: 180 SVQPYYTLLLAEEAGMTISVHATAE-RIVFTA 210 >gnl|CDD|32387 COG2205, KdpD, Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms]. Length = 890 Score = 28.7 bits (64), Expect = 1.4 Identities = 39/167 (23%), Positives = 70/167 (41%), Gaps = 39/167 (23%) Query: 16 ALLCSRICHDIISPIGAIHNSLELLDE--------------VGIEDEVMQLIRL-SSMSA 60 ALL S I HD+ +P+ AI + E L I +E +L RL +++ Sbjct: 662 ALLAS-ISHDLRTPLTAIMGAAETLLLDGEALSPEDRAELLSSIREESERLTRLVTNLLD 720 Query: 61 IIRLKFMRLAFGYTGSVDSLIGLGDIEQVIEDFIAVDKRVQVSWTGEKIDLSRER----- 115 + RL+ +G V+ + +E+V+ +R++ +TG KI +S Sbjct: 721 MTRLQ--------SGGVNLKLDWVLVEEVVG---EALQRLRKRFTGHKIVVSVPVDLPLI 769 Query: 116 -------AKILLNLFMVAHASLPRGGKVTISVQDSKNENIFSLKING 155 ++L+NL A P G ++ I+ + +FS+ G Sbjct: 770 HVDSPLIEQVLINLLENALKYAPPGSEIRINAGVERENVVFSVIDEG 816 >gnl|CDD|32537 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]. Length = 593 Score = 27.3 bits (60), Expect = 2.9 Identities = 10/39 (25%), Positives = 21/39 (53%) Query: 22 ICHDIISPIGAIHNSLELLDEVGIEDEVMQLIRLSSMSA 60 I + S G ++ ++E+L+ G+ D V+ + S +S Sbjct: 472 ILEHLRSKTGDLNAAVEILNRAGLSDAVLYRRKFSELST 510 >gnl|CDD|34340 COG4724, COG4724, Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism]. Length = 553 Score = 26.6 bits (58), Expect = 4.9 Identities = 9/26 (34%), Positives = 12/26 (46%) Query: 92 DFIAVDKRVQVSWTGEKIDLSRERAK 117 D K + +WT E+ DLS K Sbjct: 497 DDADAWKELSDNWTNEEFDLSSLAGK 522 >gnl|CDD|36490 KOG1276, KOG1276, KOG1276, Protoporphyrinogen oxidase [Coenzyme transport and metabolism]. Length = 491 Score = 26.5 bits (58), Expect = 5.3 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Query: 27 ISPIGAIH-NSLELLDEVGIEDEVMQLIRLSSMSAIIRL 64 + P G +L+L+ ++G+EDE+ Q I +S +A R Sbjct: 70 LRPAGPGGAETLDLVSDLGLEDEL-QPIDISHPAAKNRF 107 >gnl|CDD|146476 pfam03863, Phage_mat-A, Phage maturation protein. Length = 399 Score = 26.3 bits (58), Expect = 7.1 Identities = 10/35 (28%), Positives = 15/35 (42%), Gaps = 5/35 (14%) Query: 83 LGDIEQVIEDFIAVDKRVQ-----VSWTGEKIDLS 112 DI+ V EDF+ V ++ G + LS Sbjct: 209 FYDIQGVYEDFMRVHDKIAKPLRFSRGHGTNVKLS 243 >gnl|CDD|163625 cd07382, MPP_DR1281, Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain. DR1281 is an uncharacterized Deinococcus radiodurans protein with a domain that belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 255 Score = 25.9 bits (58), Expect = 8.2 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Query: 72 GYTGSVDSLIGLGDIEQVIEDFI 94 G TG DS+IG E VIE F+ Sbjct: 196 GMTGPYDSVIG-MKKEAVIERFL 217 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.140 0.390 Gapped Lambda K H 0.267 0.0661 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,504,961 Number of extensions: 129336 Number of successful extensions: 312 Number of sequences better than 10.0: 1 Number of HSP's gapped: 309 Number of HSP's successfully gapped: 19 Length of query: 215 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 125 Effective length of database: 4,318,927 Effective search space: 539865875 Effective search space used: 539865875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.1 bits)