RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780891|ref|YP_003065304.1| hypothetical protein CLIBASIA_03940 [Candidatus Liberibacter asiaticus str. psy62] (215 letters) >gnl|CDD|150730 pfam10090, DUF2328, Uncharacterized protein conserved in bacteria (DUF2328). Members of this family of hypothetical bacterial proteins have no known function. Length = 181 Score = 131 bits (333), Expect = 9e-32 Identities = 66/185 (35%), Positives = 98/185 (52%), Gaps = 7/185 (3%) Query: 30 IGAIHNSLELLDEVG--IEDEVMQLIRLSSMSAIIRLKFMRLAFGYTGSVDSLIGLGDIE 87 +GAI N LELLD+ G M LIR S+ +A RL+F RLAFG G+ I L + + Sbjct: 1 VGAIVNGLELLDDEGDPEMGPEMALIRESARNASARLRFFRLAFGAAGA-GQQIDLAEAK 59 Query: 88 QVIEDFIAVDKRVQVSWTGEKIDLSRERAKILLNLFMVAHASLPRGGKVTISVQDSKNEN 147 V+E ++A R+ + W E+ L + K+LLNL ++A +LPRGG++ + S Sbjct: 60 SVLEGYLA-GGRITLDWQLERDLLPKPEVKLLLNLLLIAEDALPRGGEIDVGEG-SDGAG 117 Query: 148 IFSLKINGNLARFPEKFTQIVDGN-VESTIDSHDIQFYYVILLAHENKIRLLPEIIDDHN 206 + + G R + G E +D+ ++QFY + LLA E L EI +D Sbjct: 118 GWRVTAEGERLRIDPDLWAALAGGAPEEELDARNVQFYLLPLLAREAGGTLSYEITEDG- 176 Query: 207 VVLSA 211 +VLSA Sbjct: 177 IVLSA 181 >gnl|CDD|182411 PRK10364, PRK10364, sensor protein ZraS; Provisional. Length = 457 Score = 31.7 bits (72), Expect = 0.16 Identities = 7/28 (25%), Positives = 19/28 (67%) Query: 117 KILLNLFMVAHASLPRGGKVTISVQDSK 144 ++LLNL++ A ++ + G ++++ +S Sbjct: 351 QVLLNLYLNAIQAIGQHGVISVTASESG 378 >gnl|CDD|173474 PTZ00198, PTZ00198, 60S ribosomal protein L22; Provisional. Length = 122 Score = 30.0 bits (68), Expect = 0.52 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Query: 78 DSLIGLGDIEQVIEDFIAVDKRVQVSWTGEKIDLSRERAKI 118 D +I L EQ ++D I VD + G K+ +SRE+ KI Sbjct: 31 DGIIDLSGFEQFLQDRIKVDGKT--GNLGNKVRVSREKNKI 69 >gnl|CDD|182962 PRK11100, PRK11100, sensory histidine kinase CreC; Provisional. Length = 475 Score = 29.0 bits (66), Expect = 1.0 Identities = 36/167 (21%), Positives = 63/167 (37%), Gaps = 33/167 (19%) Query: 24 HDIISPIGAIHNSLELLDEVGIEDEVMQL----IRLSS--MSAIIRLKFMRLAFGYTGSV 77 H++ SP+ AI + ELL E E I S + +I + + LA + Sbjct: 265 HELKSPLAAIRGAAELLQE-DPPPEDRARFTGNILTQSARLQQLID-RLLELA-----RL 317 Query: 78 DSLIGLGDIEQV-----IEDFI------AVDKRVQVSWTGEKIDLSRERAKI---LLNLF 123 + L +E V +E+ + A K + + + + + + L NL Sbjct: 318 EQRQELEVLEPVALAALLEELVEAREAQAAAKGITLRLRPDDARVLGDPFLLRQALGNLL 377 Query: 124 MVAHASLPRGGKVTISVQDSKNENIFSLKINGN------LARFPEKF 164 A P GG +T+S + + S++ G L R E+F Sbjct: 378 DNAIDFSPEGGTITLSAEVDGEQVALSVEDQGPGIPDYALPRIFERF 424 >gnl|CDD|178584 PLN03007, PLN03007, UDP-glucosyltransferase family protein. Length = 482 Score = 28.3 bits (63), Expect = 1.4 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 6/57 (10%) Query: 81 IGLGDIEQVIEDFIA---VDKRVQVSWTGEKIDLSRERAKILLNLFMVAHASLPRGG 134 +G + +V DFI+ V+K V+ GE+ + R RAK L + A A++ GG Sbjct: 412 VGAKKLVKVKGDFISREKVEKAVREVIVGEEAEERRLRAKKLAEM---AKAAVEEGG 465 >gnl|CDD|163564 TIGR03852, sucrose_gtfA, sucrose phosphorylase. In the forward direction, this enzyme uses phosphate to cleave sucrose into D-fructose + alpha-D-glucose 1-phosphate. Characterized representatives from Streptococcus mutans and Bifidobacterium adolescentis represent well-separated branches of a molecular phylogenetic tree. In S. mutans, the region including this gene has been associated with neighboring transporter genes and multiple sugar metabolism. Length = 470 Score = 28.5 bits (64), Expect = 1.4 Identities = 13/26 (50%), Positives = 16/26 (61%) Query: 182 QFYYVILLAHENKIRLLPEIIDDHNV 207 Q YYV LLA +N I LL E + N+ Sbjct: 365 QVYYVGLLAGKNDIELLEETKEGRNI 390 >gnl|CDD|183765 PRK12815, carB, carbamoyl phosphate synthase large subunit; Reviewed. Length = 1068 Score = 28.4 bits (64), Expect = 1.5 Identities = 24/106 (22%), Positives = 41/106 (38%), Gaps = 8/106 (7%) Query: 105 TGEKIDLSRERAKILLNLFMVAHASLPRGGKVTISVQDSKNENIFSLKINGNLARFPEK- 163 TGE + + ++ + L + + +P G + ISV+D + L RF + Sbjct: 909 TGEVMGIDKDLEEALYKGYEASDLHIPSYGTIFISVRDEDKPEVTKLA-----RRFAQLG 963 Query: 164 FTQIVDGNVESTIDSHDIQFYYVILLAHENKIRLLPEIIDDHNVVL 209 F + + + I V+ E LL E I H +VL Sbjct: 964 FKLLATEGTANWLAEEGITT-GVVEKVQEGSPSLL-ERIKQHRIVL 1007 >gnl|CDD|179998 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed. Length = 1066 Score = 27.8 bits (63), Expect = 2.4 Identities = 19/81 (23%), Positives = 30/81 (37%), Gaps = 17/81 (20%) Query: 79 SLIGLGDIEQVIEDFIAVDKRVQVSW----------------TGEKIDLSRERAKILLNL 122 L LG + +I ++AV K + TGE + + R + Sbjct: 868 KLAELGYTKGLIPPYVAV-KEAVFPFNKFPGVDPLLGPEMKSTGEVMGIDRTFGEAFAKA 926 Query: 123 FMVAHASLPRGGKVTISVQDS 143 + A LP G V +SV+D Sbjct: 927 QLAAGNRLPTSGTVFLSVRDR 947 >gnl|CDD|178834 PRK00062, PRK00062, glutamate-1-semialdehyde aminotransferase; Provisional. Length = 426 Score = 27.7 bits (63), Expect = 2.4 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 12/32 (37%) Query: 50 MQLIRL-SS-----MSAIIRLKFMRLAFGYTG 75 ++++R+ +S MSAI RLA GYTG Sbjct: 106 IEMVRMVNSGTEATMSAI------RLARGYTG 131 >gnl|CDD|163497 TIGR03785, marine_sort_HK, proteobacterial dedicated sortase system histidine kinase. This histidine kinase protein is paired with an adjacent response regulator (TIGR03787) gene. It co-occurs with a variant sortase enzyme (TIGR03784), usually in the same gene neighborhood, in proteobacterial species most of which are marine, and with an LPXTG motif-containing sortase target conserved protein (TIGR03788). Sortases and LPXTG proteins are far more common in Gram-positive bacteria, where sortase systems mediate attachment to the cell wall or cross-linking of pilin structures. We give this predicted sensor histidine kinase the gene symbol psdS, for Proteobacterial Dedicated Sortase system Sensor histidine kinase. Length = 703 Score = 27.4 bits (61), Expect = 3.0 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 12/57 (21%) Query: 20 SRICHDIISPIGAIHNSLELLDEVGIEDEVMQLI--------RLS----SMSAIIRL 64 SR+ H++ +P+ + +SLE L+ +E E + + RLS +MS RL Sbjct: 490 SRLSHELRTPVAVVRSSLENLELQALEQEKQKYLERAREGTERLSMILNNMSEATRL 546 >gnl|CDD|185053 PRK15098, PRK15098, beta-D-glucoside glucohydrolase; Provisional. Length = 765 Score = 26.2 bits (58), Expect = 6.5 Identities = 12/26 (46%), Positives = 18/26 (69%) Query: 30 IGAIHNSLELLDEVGIEDEVMQLIRL 55 +GAI N++ D ++D+VMQL RL Sbjct: 77 VGAIFNTVTRQDIRAMQDQVMQLSRL 102 >gnl|CDD|163113 TIGR03030, CelA, cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils. Length = 713 Score = 26.2 bits (58), Expect = 7.4 Identities = 14/81 (17%), Positives = 24/81 (29%), Gaps = 2/81 (2%) Query: 103 SWTGEKIDLSRERAKILLNLFMVAHASLPRGGKVTISVQDSKNENIFSLKINGNLARFPE 162 D S I +N L G V I + + + ++ G A Sbjct: 590 WVEATVEDASVGGLGIKINAQGAPGPQLGAGVLVQIRPKRNGLPALKPARVRG--AGGVM 647 Query: 163 KFTQIVDGNVESTIDSHDIQF 183 + NV+ + D+ F Sbjct: 648 IGLEFSPLNVQQVREIVDLVF 668 >gnl|CDD|178336 PLN02735, PLN02735, carbamoyl-phosphate synthase. Length = 1102 Score = 25.9 bits (57), Expect = 7.9 Identities = 22/85 (25%), Positives = 35/85 (41%), Gaps = 15/85 (17%) Query: 79 SLIGLGDIEQVIEDFIAVDKRV---------------QVSWTGEKIDLSRERAKILLNLF 123 SL LG E+VI ++V + V ++ TGE + + E +K Sbjct: 903 SLKDLGFTEEVIPAHVSVKEAVLPFDKFQGCDVLLGPEMRSTGEVMGIDYEFSKAFAKAQ 962 Query: 124 MVAHASLPRGGKVTISVQDSKNENI 148 + A LP G V IS+ D ++ Sbjct: 963 IAAGQRLPLSGTVFISLNDLTKPHL 987 >gnl|CDD|183098 PRK11360, PRK11360, sensory histidine kinase AtoS; Provisional. Length = 607 Score = 26.1 bits (58), Expect = 8.0 Identities = 10/43 (23%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Query: 107 EKIDLSRERAK-ILLNLFMVAHASLPRGGKVTISVQDSKNENI 148 I E K +LLN+ + A ++ GK+ I + + Sbjct: 492 PPIWADPELLKQVLLNILINAVQAISARGKIRIRTWQYSDGQV 534 >gnl|CDD|172294 PRK13756, PRK13756, tetracycline repressor protein TetR; Provisional. Length = 205 Score = 25.6 bits (56), Expect = 9.5 Identities = 10/14 (71%), Positives = 13/14 (92%) Query: 33 IHNSLELLDEVGIE 46 I ++LELL+EVGIE Sbjct: 10 IDSALELLNEVGIE 23 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.140 0.390 Gapped Lambda K H 0.267 0.0672 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,481,389 Number of extensions: 222983 Number of successful extensions: 444 Number of sequences better than 10.0: 1 Number of HSP's gapped: 441 Number of HSP's successfully gapped: 31 Length of query: 215 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 126 Effective length of database: 4,071,361 Effective search space: 512991486 Effective search space used: 512991486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.1 bits)