RPSBLAST alignment of GI: 254780891 and protein with PDBid: 2pff

>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688
 Score = 39.4 bits (91), Expect = 7e-04
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 154 NGNLARFPEKFTQIVDGNVESTIDSHDIQFYYVILLAHENKIRLL-PEIIDDHN 206
           NGNL   P  +T  VD   +  +D  D++  Y   +   + IRL+ PE+ + +N
Sbjct: 865 NGNLKGRP--YTGWVDSKTKEPVDDKDVKAKYETSILEHSGIRLIEPELFNGYN 916