HHsearch alignment for GI: 254780892 and conserved domain: COG3707

>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms].
Probab=99.62  E-value=2e-14  Score=106.40  Aligned_cols=115  Identities=22%  Similarity=0.252  Sum_probs=101.6

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEE-EECCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHCCCCCCCEEEE
Q ss_conf             97799973998999999999998898999-99997999999971799948997078998773899996143488973999
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVF-EATSVCEAREFCEKELLPNYLVIDESMEGVLEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~-~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l~~~ir~~~~~~~~pii~   79 (133)
T Consensus         5 ~lrvlv~~d~~i~~~~i~~~l~eag~~~Vg~~~~~~~~~~~~~~-~~pDvVildie~p~rd-~~e~~~~~~~~~~~piv~   82 (194)
T COG3707           5 LLRVLVADDEALTRMDIREGLLEAGYQRVGEAADGLEAVEVCER-LQPDVVILDIEMPRRD-IIEALLLASENVARPIVA   82 (194)
T ss_pred             CCCEEECCCCCCCHHHHHHHHHHCCCEEEEEECCCCCCCHHHHH-CCCCEEEEECCCCCCC-HHHHHHHHHCCCCCCEEE
T ss_conf             65303424113555678989987597387654134475067785-2998799966787732-899989860589987899


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHH
Q ss_conf             96389989999999769988997698989999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL  117 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~  117 (133)
T Consensus        83 lt~~s~p~~i~~a~~~Gv~ayivkpi~~~rl~p~L~vA  120 (194)
T COG3707          83 LTAYSDPALIEAAIEAGVMAYIVKPLDESRLLPILDVA  120 (194)
T ss_pred             EECCCCHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHH
T ss_conf             97167858999999738749883476542104799999