HHsearch alignment for GI: 254780892 and conserved domain: PRK10693

>PRK10693 response regulator of RpoS; Provisional.
Probab=99.96  E-value=3.4e-28  Score=188.40  Aligned_cols=115  Identities=23%  Similarity=0.369  Sum_probs=104.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
T Consensus         8 kkILIVDDd~~~r~~l~~~L~~~G~~V~~A~nG~eAl~~l~~-~~pDLIi~Dl~MP~mdGlell~~lr~~--~~~~PVIv   84 (337)
T PRK10693          8 KQILIVEDEPVFRSLLDSWFSSLGATTVLAADGVDALELLGG-FTPDLMICDIAMPRMNGLKFVEHLRNR--GDQTPVLV   84 (337)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHC-CCCCEEEEECCCCCCCHHHHHHHHHHH--CCCCEEEE
T ss_conf             989999499999999999999789999998999999999865-899999996899999989999999985--89964999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCC-CHHHHHHHHHHHHH
Q ss_conf             96389989999999769988997698-98999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPF-NRETLRFAMRELPQ  119 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~-~~~~L~~~i~~~~~  119 (133)
T Consensus        85 lTa~~~~~d~v~al~~GA~DyL~KPI~d~~~Lr~~v~a~l~  125 (337)
T PRK10693         85 ISATENMADIAKALRLGVEDVLLKPVKDLNRLREAVFACLY  125 (337)
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHH
T ss_conf             98689999999999749958997896999999999998751