HHsearch alignment for GI: 254780892 and conserved domain: PRK10710

>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional.
Probab=99.93  E-value=1.3e-24  Score=166.97  Aligned_cols=117  Identities=13%  Similarity=0.280  Sum_probs=107.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
T Consensus        11 ~kILlVEDd~~l~~~l~~~L~~~g~~V~~a~~~~eal~~~~~-~~~DliilDi~lp~~~Gl~l~~~lr~~---~~~piI~   86 (240)
T PRK10710         11 PRILIVEDEPKLGQLLIDYLRAASYAPTLISHGDEVLPYVRQ-TPPDLILLDLMLPGTDGLTLCREIRRF---SDIPIVM   86 (240)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHH-CCCCEEEECCCCCCCCCCCCHHHHHCC---CCCCEEE
T ss_conf             879999298999999999999889999998999999999973-799899987999888776321122115---7646899


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             9638998999999976998899769898999999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK  122 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~  122 (133)
T Consensus        87 lta~~~~~~~~~al~~GAddYl~KPf~~~eLlari~~~lrr~~  129 (240)
T PRK10710         87 VTAKIEEIDRLLGLEIGADDYICKPYSPREVVARVKTILRRCK  129 (240)
T ss_pred             ECCCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             8167888999999986998760077653899999999984523