HHsearch alignment for GI: 254780892 and conserved domain: PRK13566

>PRK13566 anthranilate synthase; Provisional.
Probab=95.24  E-value=0.097  Score=30.76  Aligned_cols=74  Identities=18%  Similarity=0.260  Sum_probs=52.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEEC--CCCCCCCHHHHHHHHCCCCCCCEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970--7899877389999614348897399
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID--ESMEGVLEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D--~~mP~~~~l~~~ir~~~~~~~~pii   78 (133)
T Consensus       524 ~rVLlVDn~DSFvhtLa~YlrqlGAeV~vvR~d-~~~~~l~~-~~pD~vvlSPGPG~P~d~g~~~~i~~-~~~~~iPil  599 (724)
T PRK13566        524 KRVLLVDHEDSFVHTLANYFRQTGAEVTTVRYP-VAEEILDR-VNPDLVVLSPGPGRPEDFDCKATIDA-ALARNLPIF  599 (724)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHHCCEEEEEECC-CCHHHHHH-HCCCEEEECCCCCCCHHCCCHHHHHH-HHHCCCCEE
T ss_conf             579998465327999999999819879998189-87677763-18898998799979000558599999-985799879