HHsearch alignment for GI: 254780892 and conserved domain: PRK13837

>PRK13837 two-component VirA-like sensor kinase; Provisional.
Probab=99.81  E-value=1.5e-18  Score=131.00  Aligned_cols=117  Identities=15%  Similarity=0.151  Sum_probs=100.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCCEEEECCCCCCCCH--HHHHHHHCCCCCCCEEE
Q ss_conf             7799973998999999999998898999999979999999717-99948997078998773--89999614348897399
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKE-LLPNYLVIDESMEGVLE--FIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~-~~pdlii~D~~mP~~~~--l~~~ir~~~~~~~~pii   78 (133)
T Consensus       700 e~ILvVdDe~~vr~~~~~~L~~lGY~v~~a~~~~~Al~~~~~~~~~~DLvltD-~~p~~~g~~~~~~l~~--~~p~lpVi  776 (831)
T PRK13837        700 ETVLLVEPDDALLERYEEKLAALGYEPVGFSTLSAAIAWISKDGKRFDLVLVD-QPSLGDSQLAIAALHA--AAPTLPII  776 (831)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEEEC-CCCCCCHHHHHHHHHH--HCCCCEEE
T ss_conf             77999859889999999999967996888689999999998389985399988-9999987999999986--18997499


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             99638998999999976998899769898999999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK  122 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~  122 (133)
T Consensus       777 -lsg~~~~~~~~~~~~~~~~~fL~KPfs~~~LA~avR~aL~~~r  819 (831)
T PRK13837        777 -LAGSSLKMAAREALATAIAEILPKPISSRTLAYALRTALATAR  819 (831)
T ss_pred             -EECCCCHHHHHCHHHCCCCEEEECCCCHHHHHHHHHHHHHCCC
T ss_conf             -9768814433110222667065099999999999999984888