HHsearch alignment for GI: 254780892 and conserved domain: cd00156

>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers.
Probab=99.93  E-value=4.8e-25  Score=169.64  Aligned_cols=111  Identities=32%  Similarity=0.541  Sum_probs=103.7

Q ss_pred             EEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEEEEC
Q ss_conf             9973998999999999998898999999979999999717999489970789987--73899996143488973999963
Q gi|254780892|r    5 LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLM   82 (133)
Q Consensus         5 LiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~lT~   82 (133)
T Consensus         1 LvVDD~~~~~~~l~~~L~~~g~~v~~a~~g~~al~~~~~~-~~dlvi~D~~mP~~~G~el~~~ir~~--~~~~pvI~lT~   77 (113)
T cd00156           1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEE-KPDLILLDIMMPGMDGLELLRRIRKR--GPDIPIIFLTA   77 (113)
T ss_pred             CEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEECCCCCCCCCHHHHHHHHHH--CCCCCEEEEEC
T ss_conf             9892729999999999998899999989999999998757-99999977999898726999999985--89995999978


Q ss_pred             CCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHH
Q ss_conf             899899999997699889976989899999999999
Q gi|254780892|r   83 EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP  118 (133)
Q Consensus        83 ~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~  118 (133)
T Consensus        78 ~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~v~~~l  113 (113)
T cd00156          78 HGDDEDAVEALKAGADDYLTKPFSPEELLARIRALL  113 (113)
T ss_pred             CCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHC
T ss_conf             789999999997689789969899999999999869