HHsearch alignment for GI: 254780892 and conserved domain: smart00448

>smart00448 REC cheY-homologous receiver domain. CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.
Probab=99.04  E-value=1.3e-09  Score=77.70  Aligned_cols=55  Identities=31%  Similarity=0.429  Sum_probs=51.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCC
Q ss_conf             77999739989999999999988989999999799999997179994899707899
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME   57 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP   57 (133)
T Consensus         1 ~kVLivdD~~~~~~~l~~~l~~~g~~v~~~~~g~~~~~~~~~~-~~dlil~D~~mP   55 (55)
T smart00448        1 MRILVVDDDPLLRELLKALLEREGYEVDEATDGEEALELLKEE-KPDLILLDIMMP   55 (55)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCC-CCCEEEEECCCC
T ss_conf             9899993799999999999997899999988999999999749-999999967687